VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Ebola virus

Table of Contents
  1. Protective Antigens
    1. EBOV NP
    2. GP from Reston ebolavirus
    3. GP from Sudan ebolavirus
    4. GP from Zaire ebolavirus
    5. NP
    6. pagA
    7. SGP
    8. VP24
    9. VP24 from Reston ebolavirus
    10. VP24 from Zaire ebolavirus
    11. VP30
    12. VP30 from Reston ebolavirus
    13. VP30 from Zaire ebolavirus
    14. VP35
    15. VP35 from Reston ebolavirus
    16. VP35 from Zaire ebolavirus
    17. VP40 from Reston ebolavirus
    18. VP40 from Zaire ebolavirus
    19. ZGP
1. EBOV NP
  • Gene Name : EBOV NP
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010859
  • NCBI Gene ID : 955194
  • NCBI Protein GI : 22789223
  • Locus Tag : REBOVgp1
  • Genbank Accession : AF522874
  • Protein Accession : NP_690580
  • Taxonomy ID : 186539
  • Gene Starting Position : 55
  • Gene Ending Position : 3012
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 4.69
  • Protein Weight : 80076.91
  • Protein Length : 739
  • DNA Sequence : Show Sequence
    >NC_004161.1:55-3012 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    TGAGGAAGATTAACAGTTTTCCTCAGTTTAAGATATACACTGAAATTGAGATTGAGATTCTCCTCTTTGC
    TATTCTGTAACTTTCCCTGGTTGTGACAATTGAATCAGTTTTATCTATTACCAATTACCATCAACATGGT
    ATGTCTAGTGATCTTGGGACTCTTCTTCATCTGGTTTTTCCTAGAGCTCTGAATCCATTTTGCGAGAAGT
    TCATCCAAACGACCCAGTGTCTGAAAATACAAAAGGTTCCCCTTTCCGTCAAGTTTAAGGGGTTGTTTTG
    ATTGTGTGTAGATTTTATAATCCTAGAGTGCCAAGGAGTTGCGTGTCATCATTGATTGGGAAGATCAAGG
    AAACAATTTGTTCCAATAATATCGTACATCTTGACTAAGTCGAACAAGGGGAAGTCGATATGGATCGTGG
    GACCAGAAGAATCTGGGTGTCGCAAAATCAAGGTGATACTGATTTAGATTATCATAAAATTTTGACAGCT
    GGCCTTACTGTTCAACAGGGAATTGTCAGGCAGAAAATAATTTCTGTATATCTTGTTGATAACTTGGAGG
    CTATGTGTCAATTGGTAATACAAGCCTTTGAGGCCGGAATTGATTTCCAAGAAAATGCCGACAGCTTCCT
    TCTGATGCTTTGCCTACATCATGCTTACCAAGGTGACTATAAATTGTTCTTGGAGAGCAATGCTGTACAG
    TATTTGGAAGGTCATGGATTCAAATTTGAGCTCCGGAAGAAGGACGGTGTCAATCGGCTCGAGGAATTGC
    TTCCTGCTGCAACGAGTGGAAAAAACATCAGGCGTACGTTGGCCGCACTGCCTGAAGAGGAGACTACAGA
    AGCAAATGCAGGGCAATTTCTCTCATTTGCGAGTTTGTTTCTTCCCAAACTGGTTGTGGGAGAGAAGGCT
    TGCTTGGAAAAAGTCCAGCGACAAATTCAGGTTCATGCAGAACAGGGTTTAATTCAATATCCCACTGCAT
    GGCAATCAGTTGGACACATGATGGTAATCTTCAGATTGATGAGGACTAATTTCTTGATTAAATATTTACT
    GATCCACCAGGGTATGCATATGGTAGCTGGCCACGATGCCAATGATGCTGTCATTGCTAATTCAGTTGCT
    CAGGCTCGCTTTTCAGGACTCCTAATTGTCAAAACCGTTCTTGATCATATTCTGCAAAAAACCGACCAAG
    GAGTAAGACTTCACCCTTTGGCCCGAACAGCCAAAGTGCGTAATGAGGTTAATGCATTTAAGGCCGCCCT
    AAGCTCACTTGCTAAGCATGGGGAATATGCCCCTTTTGCTCGCCTTCTCAATCTCTCGGGAGTTAACAAC
    CTAGAACATGGTCTCTACCCACAGTTATCAGCAATTGCTCTTGGAGTTGCCACAGCACATGGTAGCACCC
    TTGCAGGAGTTAATGTTGGTGAGCAGTATCAGCAGCTTAGAGAGGCTGCCACTGAAGCTGAGAAGCAACT
    CCAACAATATGCTGAGTCCAGAGAACTCGACAGCCTAGGCCTGGACGATCAGGAAAGAAGAATACTAATG
    AACTTCCATCAGAAGAAAAACGAAATTAGTTTCCAGCAGACCAATGCAATGGTAACCCTTAGGAAAGAGC
    GACTGGCTAAATTAACAGAAGCTATAACGCTGGCCTCAAGACCTAACCTCGGGTCTAGACAAGACGACGG
    CAATGAAATACCGTTCCCTGGGCCTATAAGCAACAACCCAGACCAAGATCATCTGGAGGATGATCCTAGA
    GACTCCAGAGACACCATCATTCCTAATGGTGCAATTGACCCCGAGGATGGTGATTTTGAAAATTACAATG
    GCTATCATGATGATGAAGTTGGGACGGCAGGTGACTTGGTCCTGTTCGATCTTGACGATCATGAGGATGA
    CAATAAAGCTTTTGAGCCACAGGACAGCTCGCCACAATCCCAAAGGGAAATAGAGAGAGAAAGATTAATT
    CATCCACCCCCAGGCAACAACAAGGACGACAATCGAGCCTCAGACAACAATCAACAATCAGCAGATTCTG
    AGGAACAAGGAGGTCAATACAACTGGCACCGAGGCCCAGAACGTACGACCGCCAATCGAAGACTCTCACC
    AGTGCACGAAGAGGACACCCTTATGGATCAAGGTGATGATGATCCCTCAAGCTTACCTCCGCTGGAATCT
    GATGATGACGATGCATCAAGTAGCCAACAAGATCCCGATTATACAGCTGTTGCCCCTCCTGCTCCTGTAT
    ACCGCAGTGCAGAAGCCCACGAGCCTCCCCACAAATCCTCGAACGAGCCAGCTGAAACATCACAATTGAA
    TGAAGACCCTGATATCGGTCAATCAAAGTCTATGCAAAAATTAGAAGAGACATATCACCATCTGCTGAGA
    ACTCAAGGTCCATTTGAAGCCATCAATTATTATCACATGATGAAGGATGAGCCGGTAATATTTAGCACTG
    ATGATGGGAAGGAATACACCTACCCGGATTCACTTGAGGAAGCCTATCCTCCATGGCTCACCGAGAAAGA
    ACGACTGGACAAAGAGAATCGCTACATTTACATAAATAATCAACAGTTCTTCTGGCCTGTCATGAGTCCC
    AGAGACAAATTTCTTGCAATCTTGCAGCACCATCAGTAACCACAGCACAAAGCGCGGTCCACTTCGTAAA
    GCTAAATACACTTAAGACTTGACCGATTCATCTACAAAAACTAATCCATTATAACTTATTAGTGCTACTT
    TTCTATAAGTGATTCTTAATCTAAGGCCATTAAGAGTTTAAGTAATATACATATACACTTACACCGGTCT
    ATCCAAGATGTGGCTCAATGTTCTTGATTTGAACATAGTCATAAGGGGATAAATAATACTTTATATTTCT
    GATTGTGGATTGACCCATTCTGCTTAAAATGCTTCGCCCATTGAAAATGTGATCTAATAGATAGCCCTGA
    CTAGACAAATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690580.1 nucleoprotein [Reston ebolavirus]
    MDRGTRRIWVSQNQGDTDLDYHKILTAGLTVQQGIVRQKIISVYLVDNLEAMCQLVIQAFEAGIDFQENA
    DSFLLMLCLHHAYQGDYKLFLESNAVQYLEGHGFKFELRKKDGVNRLEELLPAATSGKNIRRTLAALPEE
    ETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLI
    KYLLIHQGMHMVAGHDANDAVIANSVAQARFSGLLIVKTVLDHILQKTDQGVRLHPLARTAKVRNEVNAF
    KAALSSLAKHGEYAPFARLLNLSGVNNLEHGLYPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEA
    EKQLQQYAESRELDSLGLDDQERRILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITLASRPNLGSR
    QDDGNEIPFPGPISNNPDQDHLEDDPRDSRDTIIPNGAIDPEDGDFENYNGYHDDEVGTAGDLVLFDLDD
    HEDDNKAFEPQDSSPQSQREIERERLIHPPPGNNKDDNRASDNNQQSADSEEQGGQYNWHRGPERTTANR
    RLSPVHEEDTLMDQGDDDPSSLPPLESDDDDASSSQQDPDYTAVAPPAPVYRSAEAHEPPHKSSNEPAET
    SQLNEDPDIGQSKSMQKLEETYHHLLRTQGPFEAINYYHMMKDEPVIFSTDDGKEYTYPDSLEEAYPPWL
    TEKERLDKENRYIYINNQQFFWPVMSPRDKFLAILQHHQ
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): GP-VRP , NP-VRP
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.217
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
2. GP from Reston ebolavirus
  • Gene Name : GP from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010858
  • NCBI Gene ID : 955190
  • NCBI Protein GI : 22789230
  • Locus Tag : REBOVgp4
  • Genbank Accession : AF522874
  • Protein Accession : NP_690583
  • Taxonomy ID : 186539
  • Gene Starting Position : 5900
  • Gene Ending Position : 8255
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 6.35
  • Protein Weight : 71040.95
  • Protein Length : 677
  • DNA Sequence : Show Sequence
    >NC_004161.1:5900-8255 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    CGATGAAGATTAAGGCGACAACGAGCCGAAACTTCATCTCTTTTAAAGATCTAACATTATCTGTTCCAAA
    GTCATACAAGGACACATTCAAATCAGGGATTGTAAGCTGCTATTTCTTACCTCCCCAAATTACCTATACA
    ACATGGGGTCAGGATATCAACTTCTCCAATTGCCTCGGGAACGTTTTCGTAAAACTTCGTTCTTAGTATG
    GGTAATCATCCTCTTCCAGCGAGCAATCTCCATGCCGCTTGGTATAGTGACAAATAGCACTCTCAAAGCA
    ACAGAAATTGATCAATTGGTTTGTCGGGACAAACTGTCATCAACCAGTCAGCTCAAGTCTGTGGGGCTGA
    ATCTGGAAGGAAATGGAATTGCAACCGATGTCCCATCAGCAACAAAACGCTGGGGATTTCGTTCAGGTGT
    GCCTCCCAAGGTGGTCAGCTATGAAGCCGGAGAATGGGCAGAAAATTGCTACAATCTGGAGATCAAAAAG
    TCAGACGGAAGTGAATGCCTCCCTCTCCCTCCCGACGGTGTACGAGGATTCCCTAGATGTCGCTATGTCC
    ACAAAGTTCAAGGAACAGGTCCTTGTCCTGGTGACTTAGCTTTCCATAAAAATGGGGCTTTTTTCTTGTA
    TGATAGATTGGCCTCAACTGTCATCTACCGAGGGACAACTTTTGCTGAAGGTGTCGTAGCTTTTTTAATT
    CTGTCAGAGCCCAAGAAGCATTTTTGGAAGGCTACACCAGCTCATGAACCGGTGAACACAACAGATGATT
    CCACAAGCTACTACATGACCCTGACACTCAGCTACGAGATGTCAAATTTTGGGGGCAATGAAAGCAACAC
    CCTTTTTAAGGTAGACAACCACACATATGTGCAACTAGATCGTCCACACACTCCGCAGTTCCTTGTTCAG
    CTCAATGAAACACTTCGAAGAAATAATCGCCTTAGCAACAGTACAGGGAGATTGACTTGGACATTGGATC
    CTAAAATTGAACCAGATGTTGGTGAGTGGGCCTTCTGGGAAACTAAAAAAACTTTTCCCAACAACTTCAT
    GGAGAAAACTTGCATTTCCAAATTCCATCAACCCACACCAACAACTCCTCAGATCAGAGCCCGGCGGGAA
    CTGTCCAAGGAAAAATTAGCTACCACCCACCCGCCAACAACTCCGAGCTGGTTCCAACGGATTCCCCTCC
    AGTGGTTTCAGTGCTCACTGCAGGACGGACAGAGGAAATGTCGACCCAAGGTCTAACCAACGGAGAGACA
    ATCACAGGTTTCACCGCGAACCCAATGACAACCACCATTGCCCCAAGTCCAACCATGACAAGCGAGGTTG
    ATAACAATGTACCAAGTGAACAGCCGAACAACACAGCATCCATTGAAGACTCCCCCCCATCGGCAAGCAA
    CGAGACAATTTACCACTCCGAGATGGATCCGATCCAAGGCTCGAACAACTCCGCCCAGAGCCCACAGACC
    AAGACCACGCCAGCACCCACAACATCCCCGATGACCCAGGACCCGCAAGAGACGGCCAACAGCAGCAAAC
    CAGGAACCAGCCCAGGAAGCGCAGCCGGACCAAGTCAGCCCGGACTCACTATAAATACAGTAAGTAAGGT
    AGCTGATTCACTGAGTCCCACCAGGAAACAAAAGCGATCGGTTCGACAAAACACCGCTAATAAATGTAAC
    CCAGATCTTTACTATTGGACAGCTGTTGATGAGGGGGCAGCAGTAGGATTGGCATGGATTCCATATTTCG
    GACCTGCAGCAGAAGGCATCTACATTGAGGGTGTAATGCATAATCAGAATGGGCTTATTTGCGGGCTACG
    TCAGCTAGCCAATGAAACTACCCAGGCTCTTCAATTATTTCTGCGGGCCACAACAGAACTGAGGACTTAC
    TCACTTCTTAACAGAAAAGCTATTGATTTTCTTCTTCAACGATGGGGAGGTACCTGTCGAATCCTAGGAC
    CATCTTGTTGCATTGAGCCACATGATTGGACAAAAAATATTACTGATGAAATTAACCAAATTAAACATGA
    CTTTATTGACAATCCCCTACCAGACCACGGAGATGATCTTAATCTATGGACAGGTTGGAGACAATGGATC
    CCGGCTGGAATTGGGATTATTGGAGTTATAATTGCTATAATAGCCCTACTTTGTATATGTAAGATTTTGT
    GTTGATTTATTCTGAGATCTGAGAGAGAAAAATCTCAGGGTTACTCTAAGGAGAAATATTATTTTTAAAA
    TTTACTTGAATGCTGACCACTTATCTTAAATGAGCAATTAATAATATGTTTTTCTGCTTCTTTGCTTGAT
    TTACAATATGATATTTCTCTTAATAATGATTAATATATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690583.1 spike glycoprotein [Reston ebolavirus]
    MGSGYQLLQLPRERFRKTSFLVWVIILFQRAISMPLGIVTNSTLKATEIDQLVCRDKLSSTSQLKSVGLN
    LEGNGIATDVPSATKRWGFRSGVPPKVVSYEAGEWAENCYNLEIKKSDGSECLPLPPDGVRGFPRCRYVH
    KVQGTGPCPGDLAFHKNGAFFLYDRLASTVIYRGTTFAEGVVAFLILSEPKKHFWKATPAHEPVNTTDDS
    TSYYMTLTLSYEMSNFGGNESNTLFKVDNHTYVQLDRPHTPQFLVQLNETLRRNNRLSNSTGRLTWTLDP
    KIEPDVGEWAFWETKKNFSQQLHGENLHFQIPSTHTNNSSDQSPAGTVQGKISYHPPANNSELVPTDSPP
    VVSVLTAGRTEEMSTQGLTNGETITGFTANPMTTTIAPSPTMTSEVDNNVPSEQPNNTASIEDSPPSASN
    ETIYHSEMDPIQGSNNSAQSPQTKTTPAPTTSPMTQDPQETANSSKPGTSPGSAAGPSQPGLTINTVSKV
    ADSLSPTRKQKRSVRQNTANKCNPDLYYWTAVDEGAAVGLAWIPYFGPAAEGIYIEGVMHNQNGLICGLR
    QLANETTQALQLFLRATTELRTYSLLNRKAIDFLLQRWGGTCRILGPSCCIEPHDWTKNITDEINQIKHD
    FIDNPLPDHGDDLNLWTGWRQWIPAGIGIIGVIIAIIALLCICKILC
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): DNA vaccine expressing sGP , GP-VRP
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.701
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
3. GP from Sudan ebolavirus
  • Gene Name : GP from Sudan ebolavirus
  • Sequence Strain (Species/Organism) : Sudan ebolavirus
  • VO ID : VO_0010911
  • NCBI Gene ID : 3160774
  • NCBI Protein GI : 55770812
  • Locus Tag : SEVgp4
  • Genbank Accession : AY316199
  • Protein Accession : YP_138523
  • Taxonomy ID : 186540
  • Gene Starting Position : 5882
  • Gene Ending Position : 8240
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 6.35
  • Protein Weight : 71813.2
  • Protein Length : 676
  • Protein Note : forms dimers linked by disulfide bonds (parallel orientation); processed by furin to yield SGP and delta peptide
  • DNA Sequence : Show Sequence
    >NC_006432.1:5882-8240 Sudan ebolavirus isolate Sudan virus/H.sapiens-tc/UGA/2000/Gulu-808892, complete genome
    TGATGAAGATTAAGCCTGATGAAGGCCCAACCTTCATCTTTTTACCATAATCTTGTTCTCAGTACCATTT
    GATAAGGGTACACTTGCCAATACGCCCCCATCCTAAGGGTCTCGCAATGGGGGGTCTTAGCCTACTCCAA
    TTGCCCAGGGACAAATTTCGGAAAAGCTCTTTCTTTGTTTGGGTCATCATCTTATTCCAAAAGGCCTTTT
    CCATGCCTTTGGGTGTTGTGACTAACAGCACTTTAGAAGTAACAGAGATTGACCAGCTAGTCTGCAAGGA
    TCATCTTGCATCTACTGACCAGCTGAAATCAGTTGGTCTCAACCTCGAGGGGAGCGGAGTATCTACTGAT
    ATCCCATCTGCAACAAAGCGTTGGGGCTTCAGATCTGGTGTTCCTCCCAAGGTGGTCAGCTATGAAGCGG
    GAGAATGGGCTGAAAATTGCTACAATCTTGAAATAAAGAAGCCGGACGGGAGCGAATGCTTACCCCCACC
    GCCAGATGGTGTCAGAGGCTTTCCAAGGTGCCGCTATGTTCACAAAGCCCAAGGAACCGGGCCCTGCCCA
    GGTGACTACGCCTTTCACAAGGATGGAGCTTTCTTCCTCTATGACAGGCTGGCTTCAACTGTAATTTACA
    GAGGAGTCAATTTTGCTGAGGGGGTAATTGCATTCTTGATATTGGCTAAACCAAAAGAAACGTTCCTTCA
    GTCACCCCCCATTCGAGAGGCAGTAAACTACACTGAAAATACATCAAGTTATTATGCCACATCCTACTTG
    GAGTATGAAATCGAAAATTTTGGTGCTCAACACTCCACGACCCTTTTCAAAATTGACAATAATACTTTTG
    TTCGTCTGGACAGGCCCCACACGCCTCAGTTCCTTTTCCAGCTGAATGATACCATTCACCTTCACCAACA
    GTTGAGTAATACAACTGGGAGACTAATTTGGACACTAGATGCTAATATCAATGCTGATATTGGTGAATGG
    GCTTTTTGGGAAAATAAAAAAATCTCTCCGAACAACTACGTGGAGAAGAGCTGTCTTTCGAAGCTTTATC
    GCTCAACGAGACAGAAGACGATGATGCGGCATCGTCGAGAATTACAAAGGGAAGAATCTCCGACCGGGCC
    ACCAGGAAGTATTCGGACCTGGTTCCAAAGAATTCCCCTGGGATGGTTCCATTGCACATACCAGAAGGGG
    AAACAACATTGCCGTCTCAGAATTCGACAGAAGGTCGAAGAGTAGGTGTGAACACTCAGGAGACCATTAC
    AGAGACAGCTGCAACAATTATAGGCACTAACGGCAACCATATGCAGATCTCCACCATCGGGATAAGACCG
    AGCTCCAGCCAAATCCCGAGTTCCTCACCGACCACGGCACCAAGCCCTGAGGCTCAGACCCCCACAACCC
    ACACATCAGGTCCATCAGTGATGGCCACCGAGGAACCAACAACACCACCGGGAAGCTCCCCCGGCCCAAC
    AACAGAAGCACCCACTCTCACCACCCCAGAAAATATAACAACAGCGGTTAAAACTGTCCTGCCACAGGAG
    TCCACAAGCAACGGTCTAATAACTTCAACAGTAACAGGGATTCTTGGGAGTCTTGGGCTTCGAAAACGCA
    GCAGAAGACAAACTAACACCAAAGCCACGGGTAAGTGCAATCCCAACTTACACTACTGGACTGCACAAGA
    ACAACATAATGCTGCTGGGATTGCCTGGATCCCGTACTTTGGACCGGGTGCGGAAGGCATATACACTGAA
    GGCCTGATGCATAACCAAAATGCCTTAGTCTGTGGACTTAGGCAACTTGCAAATGAAACAACTCAAGCTC
    TGCAGCTTTTCTTAAGAGCCACAACGGAGCTGCGGACATATACCATACTCAATAGGAAGGCCATAGATTT
    CCTTCTGCGACGATGGGGCGGGACATGCAGGATCCTGGGACCAGATTGTTGCATTGAGCCACATGATTGG
    ACAAAAAACATCACTGATAAAATCAACCAAATCATCCATGATTTCATCGACAACCCCTTACCTAATCAGG
    ATAATGATGATAATTGGTGGACGGGCTGGAGACAGTGGATCCCTGCAGGAATAGGCATTACTGGAATTAT
    TATTGCAATTATTGCTCTTCTTTGCGTTTGCAAGCTGCTTTGCTGAATATCAATTTGAATCATCAATTTA
    AGCTTGATACATTTCTAGCATTTTAAATTATAAACCGATACTGATACTTGAAAATCAGGCTAATGCCAAG
    TTCTGTGCAAAACTTGAAAGTAGGTTTACAAAAATCCTTTGGACTGGAATGCTTTGATACTCTTTCTCAA
    TACTATATAAGTTCCTTCCCAAGAATAATATTGATGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >YP_138523.1 spike glycoprotein [Sudan ebolavirus]
    MGGLSLLQLPRDKFRKSSFFVWVIILFQKAFSMPLGVVTNSTLEVTEIDQLVCKDHLASTDQLKSVGLNL
    EGSGVSTDIPSATKRWGFRSGVPPKVVSYEAGEWAENCYNLEIKKPDGSECLPPPPDGVRGFPRCRYVHK
    AQGTGPCPGDYAFHKDGAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPKETFLQSPPIREAVNYTENTS
    SYYATSYLEYEIENFGAQHSTTLFKIDNNTFVRLDRPHTPQFLFQLNDTIHLHQQLSNTTGRLIWTLDAN
    INADIGEWAFWENKKNLSEQLRGEELSFEALSLNETEDDDAASSRITKGRISDRATRKYSDLVPKNSPGM
    VPLHIPEGETTLPSQNSTEGRRVGVNTQETITETAATIIGTNGNHMQISTIGIRPSSSQIPSSSPTTAPS
    PEAQTPTTHTSGPSVMATEEPTTPPGSSPGPTTEAPTLTTPENITTAVKTVLPQESTSNGLITSTVTGIL
    GSLGLRKRSRRQTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQ
    LANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDF
    IDNPLPNQDNDDNWWTGWRQWIPAGIGITGIIIAIIALLCVCKLLC
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Cynomolgus macaques were immunized with DNA/rAd5 vaccines expressing ZEBOV (GP) and SEBOV glycoprotein (GP) prior to lethal challenge with BEBOV. Vaccinated subjects developed robust, antigen-specific humoral and cellular immune responses against the GP from ZEBOV as well as cellular immunity against BEBOV GP, and immunized macaques were uniformly protected against lethal challenge with BEBOV (Hensley et al., 2010).
  • Related Vaccine(s): cAdVax-based bivalent ebola virus vaccine (Sudan and Zaire species) , CAdVax-ZEBOV/SEBOV , Ebola virus DNA vaccine DNA/rAd5 encoding ZEBOV and SEBOV antigens , Ebola virus DNA vaccine encoding ZEBOV GP and SEBOV GP , Ebola virus recombinant vector vaccine EBO7 encoding GP from SEBOV and ZEBOV
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.448
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
4. GP from Zaire ebolavirus
  • Gene Name : GP from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010910
  • NCBI Gene ID : 911829
  • NCBI Protein GI : 10313995
  • Locus Tag : ZEBOVgp4
  • Genbank Accession : AF272001
  • Protein Accession : NP_066246
  • Taxonomy ID : 186538
  • Gene Starting Position : 5899
  • Gene Ending Position : 8304
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 6.6
  • Protein Weight : 70989.69
  • Protein Length : 676
  • Protein Note : sGP secreted as a anti-parallel oriented homodimer
  • DNA Sequence : Show Sequence
    >NC_002549.1:5899-8304 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    CGATGAAGATTAAGCCGACAGTGAGCGTAATCTTCATCTCTCTTAGATTATTTGTTTTCCAGAGTAGGGG
    TCGTCAGGTCCTTTTCAATCGTGTAACCAAAATAAACTCCACTAGAAGGATATTGTGGGGCAACAACACA
    ATGGGCGTTACAGGAATATTGCAGTTACCTCGTGATCGATTCAAGAGGACATCATTCTTTCTTTGGGTAA
    TTATCCTTTTCCAAAGAACATTTTCCATCCCACTTGGAGTCATCCACAATAGCACATTACAGGTTAGTGA
    TGTCGACAAACTAGTTTGTCGTGACAAACTGTCATCCACAAATCAATTGAGATCAGTTGGACTGAATCTC
    GAAGGGAATGGAGTGGCAACTGACGTGCCATCTGCAACTAAAAGATGGGGCTTCAGGTCCGGTGTCCCAC
    CAAAGGTGGTCAATTATGAAGCTGGTGAATGGGCTGAAAACTGCTACAATCTTGAAATCAAAAAACCTGA
    CGGGAGTGAGTGTCTACCAGCAGCGCCAGACGGGATTCGGGGCTTCCCCCGGTGCCGGTATGTGCACAAA
    GTATCAGGAACGGGACCGTGTGCCGGAGACTTTGCCTTCCATAAAGAGGGTGCTTTCTTCCTGTATGATC
    GACTTGCTTCCACAGTTATCTACCGAGGAACGACTTTCGCTGAAGGTGTCGTTGCATTTCTGATACTGCC
    CCAAGCTAAGAAGGACTTCTTCAGCTCACACCCCTTGAGAGAGCCGGTCAATGCAACGGAGGACCCGTCT
    AGTGGCTACTATTCTACCACAATTAGATATCAGGCTACCGGTTTTGGAACCAATGAGACAGAGTACTTGT
    TCGAGGTTGACAATTTGACCTACGTCCAACTTGAATCAAGATTCACACCACAGTTTCTGCTCCAGCTGAA
    TGAGACAATATATACAAGTGGGAAAAGGAGCAATACCACGGGAAAACTAATTTGGAAGGTCAACCCCGAA
    ATTGATACAACAATCGGGGAGTGGGCCTTCTGGGAAACTAAAAAAACCTCACTAGAAAAATTCGCAGTGA
    AGAGTTGTCTTTCACAGTTGTATCAAACGGAGCCAAAAACATCAGTGGTCAGAGTCCGGCGCGAACTTCT
    TCCGACCCAGGGACCAACACAACAACTGAAGACCACAAAATCATGGCTTCAGAAAATTCCTCTGCAATGG
    TTCAAGTGCACAGTCAAGGAAGGGAAGCTGCAGTGTCGCATCTAACAACCCTTGCCACAATCTCCACGAG
    TCCCCAATCCCTCACAACCAAACCAGGTCCGGACAACAGCACCCATAATACACCCGTGTATAAACTTGAC
    ATCTCTGAGGCAACTCAAGTTGAACAACATCACCGCAGAACAGACAACGACAGCACAGCCTCCGACACTC
    CCTCTGCCACGACCGCAGCCGGACCCCCAAAAGCAGAGAACACCAACACGAGCAAGAGCACTGACTTCCT
    GGACCCCGCCACCACAACAAGTCCCCAAAACCACAGCGAGACCGCTGGCAACAACAACACTCATCACCAA
    GATACCGGAGAAGAGAGTGCCAGCAGCGGGAAGCTAGGCTTAATTACCAATACTATTGCTGGAGTCGCAG
    GACTGATCACAGGCGGGAGAAGAACTCGAAGAGAAGCAATTGTCAATGCTCAACCCAAATGCAACCCTAA
    TTTACATTACTGGACTACTCAGGATGAAGGTGCTGCAATCGGACTGGCCTGGATACCATATTTCGGGCCA
    GCAGCCGAGGGAATTTACATAGAGGGGCTAATGCACAATCAAGATGGTTTAATCTGTGGGTTGAGACAGC
    TGGCCAACGAGACGACTCAAGCTCTTCAACTGTTCCTGAGAGCCACAACTGAGCTACGCACCTTTTCAAT
    CCTCAACCGTAAGGCAATTGATTTCTTGCTGCAGCGATGGGGCGGCACATGCCACATTCTGGGACCGGAC
    TGCTGTATCGAACCACATGATTGGACCAAGAACATAACAGACAAAATTGATCAGATTATTCATGATTTTG
    TTGATAAAACCCTTCCGGACCAGGGGGACAATGACAATTGGTGGACAGGATGGAGACAATGGATACCGGC
    AGGTATTGGAGTTACAGGCGTTATAATTGCAGTTATCGCTTTATTCTGTATATGCAAATTTGTCTTTTAG
    TTTTTCTTCAGATTGCTTCATGGAAAAGCTCAGCCTCAAATCAATGAAACCAGGATTTAATTATATGGAT
    TACTTGAATCTAAGATTACTTGACAAATGATAATATAATACACTGGAGCTTTAAACATAGCCAATGTGAT
    TCTAACTCCTTTAAACTCACAGTTAATCATAAACAAGGTTTGACATCAATCTAGTTATCTCTTTGAGAAT
    GATAAACTTGATGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066246.1 spike glycoprotein [Zaire ebolavirus]
    MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNL
    EGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHK
    VSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPS
    SGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPE
    IDTTIGEWAFWETKKNLTRKIRSEELSFTVVSNGAKNISGQSPARTSSDPGTNTTTEDHKIMASENSSAM
    VQVHSQGREAAVSHLTTLATISTSPQSLTTKPGPDNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDT
    PSATTAAGPPKAENTNTSKSTDFLDPATTTSPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVA
    GLITGGRRTRREAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQ
    LANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDF
    VDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Cynomolgus macaques were immunized with DNA/rAd5 vaccines expressing ZEBOV (GP) and SEBOV glycoprotein (GP) prior to lethal challenge with BEBOV. Vaccinated subjects developed robust, antigen-specific humoral and cellular immune responses against the GP from ZEBOV as well as cellular immunity against BEBOV GP, and immunized macaques were uniformly protected against lethal challenge with BEBOV (Hensley et al., 2010).
  • Related Vaccine(s): cAdVax-based bivalent ebola virus vaccine (Sudan and Zaire species) , CAdVax-ZEBOV/SEBOV , Ebola virus DNA vaccine DNA/rAd5 encoding ZEBOV and SEBOV antigens , Ebola virus DNA vaccine EBOV GP , Ebola virus DNA vaccine encoding ZEBOV GP and SEBOV GP , Ebola virus DNA vaccine GP DNA , Ebola virus recombinant adenovirus vaccine AdC7-ZGP encoding GP , Ebola virus recombinant adenovirus vector vaccine ADV−GP/NP , Ebola virus recombinant rAD-GP encoding GP , Ebola virus recombinant vector vaccine Ad-CAGoptZGP encoding the envelope glycoprotein , Ebola virus recombinant vector vaccine Ad-CMVZGP encoding the glycoprotein , Ebola virus recombinant vector vaccine EBO7 encoding GP from SEBOV and ZEBOV , Ebola virus recombinant vector vaccine pVSVXN2∆G/ZEBOVsGP encoding GP , Ebola virus recombinant VSVΔG-GP encoding GP , rAd-GP (Ebola virus) , rVSV-EBOV
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.699
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
5. NP
  • Gene Name : NP
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010912
  • NCBI Gene ID : 911830
  • NCBI Protein GI : 10314000
  • Locus Tag : ZEBOVgp1
  • Genbank Accession : AY142960
  • Protein Accession : NP_066243
  • Taxonomy ID : 186538
  • Gene Starting Position : 55
  • Gene Ending Position : 3025
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 4.77
  • Protein Weight : 79118.19
  • Protein Length : 739
  • DNA Sequence : Show Sequence
    >NC_002549.1:55-3025 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGAGGAAGATTAATAATTTTCCTCTCATTGAAATTTATATCGGAATTTAAATTGAAATTGTTACTGTAAT
    CACACCTGGTTTGTTTCAGAGCCACATCACAAAGATAGAGAACAACCTAGGTCTCCGAAGGGAGCAAGGG
    CATCAGTGTGCTCAGTTGAAAATCCCTTGTCAACACCTAGGTCTTATCACATCACAAGTTCCACCTCAGA
    CTCTGCAGGGTGATCCAACAACCTTAATAGAAACATTATTGTTAAAGGACAGCATTAGTTCACAGTCAAA
    CAAGCAAGATTGAGAATTAACCTTGGTTTTGAACTTGAACACTTAGGGGATTGAAGATTCAACAACCCTA
    AAGCTTGGGGTAAAACATTGGAAATAGTTAAAAGACAAATTGCTCGGAATCACAAAATTCCGAGTATGGA
    TTCTCGTCCTCAGAAAATCTGGATGGCGCCGAGTCTCACTGAATCTGACATGGATTACCACAAGATCTTG
    ACAGCAGGTCTGTCCGTTCAACAGGGGATTGTTCGGCAAAGAGTCATCCCAGTGTATCAAGTAAACAATC
    TTGAAGAAATTTGCCAACTTATCATACAGGCCTTTGAAGCAGGTGTTGATTTTCAAGAGAGTGCGGACAG
    TTTCCTTCTCATGCTTTGTCTTCATCATGCGTACCAGGGAGATTACAAACTTTTCTTGGAAAGTGGCGCA
    GTCAAGTATTTGGAAGGGCACGGGTTCCGTTTTGAAGTCAAGAAGCGTGATGGAGTGAAGCGCCTTGAGG
    AATTGCTGCCAGCAGTATCTAGTGGAAAAAACATTAAGAGAACACTTGCTGCCATGCCGGAAGAGGAGAC
    AACTGAAGCTAATGCCGGTCAGTTTCTCTCCTTTGCAAGTCTATTCCTTCCGAAATTGGTAGTAGGAGAA
    AAGGCTTGCCTTGAGAAGGTTCAAAGGCAAATTCAAGTACATGCAGAGCAAGGACTGATACAATATCCAA
    CAGCTTGGCAATCAGTAGGACACATGATGGTGATTTTCCGTTTGATGCGAACAAATTTTCTGATCAAATT
    TCTCCTAATACACCAAGGGATGCACATGGTTGCCGGGCATGATGCCAACGATGCTGTGATTTCAAATTCA
    GTGGCTCAAGCTCGTTTTTCAGGCTTATTGATTGTCAAAACAGTACTTGATCATATCCTACAAAAGACAG
    AACGAGGAGTTCGTCTCCATCCTCTTGCAAGGACCGCCAAGGTAAAAAATGAGGTGAACTCCTTTAAGGC
    TGCACTCAGCTCCCTGGCCAAGCATGGAGAGTATGCTCCTTTCGCCCGACTTTTGAACCTTTCTGGAGTA
    AATAATCTTGAGCATGGTCTTTTCCCTCAACTATCGGCAATTGCACTCGGAGTCGCCACAGCACACGGGA
    GTACCCTCGCAGGAGTAAATGTTGGAGAACAGTATCAACAACTCAGAGAGGCTGCCACTGAGGCTGAGAA
    GCAACTCCAACAATATGCAGAGTCTCGCGAACTTGACCATCTTGGACTTGATGATCAGGAAAAGAAAATT
    CTTATGAACTTCCATCAGAAAAAGAACGAAATCAGCTTCCAGCAAACAAACGCTATGGTAACTCTAAGAA
    AAGAGCGCCTGGCCAAGCTGACAGAAGCTATCACTGCTGCGTCACTGCCCAAAACAAGTGGACATTACGA
    TGATGATGACGACATTCCCTTTCCAGGACCCATCAATGATGACGACAATCCTGGCCATCAAGATGATGAT
    CCGACTGACTCACAGGATACGACCATTCCCGATGTGGTGGTTGATCCCGATGATGGAAGCTACGGCGAAT
    ACCAGAGTTACTCGGAAAACGGCATGAATGCACCAGATGACTTGGTCCTATTCGATCTAGACGAGGACGA
    CGAGGACACTAAGCCAGTGCCTAATAGATCGACCAAGGGTGGACAACAGAAGAACAGTCAAAAGGGCCAG
    CATATAGAGGGCAGACAGACACAATCCAGGCCAATTCAAAATGTCCCAGGCCCTCACAGAACAATCCACC
    ACGCCAGTGCGCCACTCACGGACAATGACAGAAGAAATGAACCCTCCGGCTCAACCAGCCCTCGCATGCT
    GACACCAATTAACGAAGAGGCAGACCCACTGGACGATGCCGACGACGAGACGTCTAGCCTTCCGCCCTTG
    GAGTCAGATGATGAAGAGCAGGACAGGGACGGAACTTCCAACCGCACACCCACTGTCGCCCCACCGGCTC
    CCGTATACAGAGATCACTCTGAAAAGAAAGAACTCCCGCAAGACGAGCAACAAGATCAGGACCACACTCA
    AGAGGCCAGGAACCAGGACAGTGACAACACCCAGTCAGAACACTCTTTTGAGGAGATGTATCGCCACATT
    CTAAGATCACAGGGGCCATTTGATGCTGTTTTGTATTATCATATGATGAAGGATGAGCCTGTAGTTTTCA
    GTACCAGTGATGGCAAAGAGTACACGTATCCAGACTCCCTTGAAGAGGAATATCCACCATGGCTCACTGA
    AAAAGAGGCTATGAATGAAGAGAATAGATTTGTTACATTGGATGGTCAACAATTTTATTGGCCGGTGATG
    AATCACAAGAATAAATTCATGGCAATCCTGCAACATCATCAGTGAATGAGCATGGAACAATGGGATGATT
    CAACCGACAAATAGCTAACATTAAGTAGTCAAGGAACGAAAACAGGAAGAATTTTTGATGTCTAAGGTGT
    GAATTATTATCACAATAAAAGTGATTCTTATTTTTGAATTTAAAGCTAGCTTATTATTACTAGCCGTTTT
    TCAAAGTTCAATTTGAGTCTTAATGCAAATAGGCGTTAAGCCACAGTTATAGCCATAATTGTAACTCAAT
    ATTCTAACTAGCGATTTATCTAAATTAAATTACATTATGCTTTTATAACTTACCTACTAGCCTGCCCAAC
    ATTTACACGATCGTTTTATAATTAAGAAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066243.1 nucleoprotein [Zaire ebolavirus]
    MDSRPQKIWMAPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESA
    DSFLLMLCLHHAYQGDYKLFLESGAVKYLEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEE
    ETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLI
    KFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNEVNSF
    KAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEA
    EKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITAASLPKTSGH
    YDDDDDIPFPGPINDDDNPGHQDDDPTDSQDTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVLFDLDE
    DDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPR
    MLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDH
    TQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWL
    TEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Guinea pigs infected with a single intranasal inoculation of HPIV3/EboGP-NP showed no apparent signs of disease yet developed a strong humoral response specific to the EV proteins. When these animals were challenged with an intraperitoneal injection of 10(3) PFU of EV, there were no outward signs of disease, no viremia or detectable EV antigen in the blood, and no evidence of infection in the spleen, liver, and lungs. In contrast, all of the control animals died or developed severe EV disease following challenge (Bukreyev et al., 2006).
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.203
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
6. pagA
  • Gene Name : pagA
  • Sequence Strain (Species/Organism) : Bacillus anthracis
  • NCBI Protein GI : BAD14937
  • Other Database IDs : CDD:281492
  • Taxonomy ID : 1392
  • Protein Name : pagA
  • Protein pI : 6.4
  • Protein Weight : 24803.18
  • Protein Length : 302
  • Protein Note : a partial cDNA fragment of pag gene generated a Eco RV site in the middle of the sequence by the overlap extension PCR
  • Protein Sequence : Show Sequence
    >BAD14937.1 pagA, partial (plasmid) [Bacillus anthracis]
    KRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSD
    FEKVTGRIDKNVSPEARHPLVAAYPIVHVDIENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHG
    NAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNADIRYVNTGTAPIY
    NVLPTTSLVLGKNQTLATIKAKENQLSQIL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Garufi et al., 2012)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.797
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
7. SGP
  • Gene Name : SGP
  • Sequence Strain (Species/Organism) : Sudan ebolavirus strain Boniface
  • NCBI Nucleotide GI : 1041223
  • NCBI Protein GI : 1041225
  • Protein Accession : AAB37096.1
  • Other Database IDs : CDD:279888
    CDD:197367
  • Taxonomy ID : 186540
  • Gene Strand (Orientation) : ?
  • Protein Name : virion spike glycoprotein precursor
  • Protein pI : 5.67
  • Protein Weight : 72335.57
  • Protein Length : 754
  • Protein Note : subtype: Sudan
  • DNA Sequence : Show Sequence
    >gi|1041223|gb|U28134.1|EVU28134 Sudan Ebola virus strain Boniface virion spike glycoprotein (SP) gene, complete cds, and small/secreted glycoprotein precursor (SGP) gene, complete cds
    ATTTGATGAAGATTAAGCCTGATTAAGGCCCAACCTTCATCTTTTTACCATAATCTTGTTCTCAATACCA
    TTTAATAGGGGTATACTTGCCAAAGCGCCCCCATCCTCAGGATCTCGCAATGGAGGGTCTTAGCCTACTC
    CAATTGCCCAGAGATAAATTTCGAAAAAGCTCTTTCTTTGTTTGGGTCATCATCTTATTTCAAAAGGCCT
    TTTCCATGCCTTTGGGTGTTGTGACCAACAGCACTTTAGAAGTAACAGAGATTGACCAGCTAGTCTGCAA
    GGATCATCTTGCATCAACTGACCAGCTGAAATCAGTTGGTCTCAACCTCGAGGGGAGCGGAGTATCTACT
    GATATCCCATCTGCGACAAAGCGTTGGGGCTTCAGATCTGGTGTGCCTCCCCAAGTGGTCAGCTATGAAG
    CAGGAGAATGGGCTGAAAATTGCTACAATCTTGAAATAAAGAAACCGGACGGGAGCGAATGCTTACCCCC
    ACCGCCGGATGGTGTCAGAGGCTTTCCAAGGTGCCGCTATGTTCACAAAGCCCAAGGAACCGGGCCCTGC
    CCGGGTGACTATGCCTTTCACAAGGATGGAGCTTTCTTCCTCTATGACAGGCTGGCTTCAACTGTAATTT
    ACAGAGGAGTCAATTTTGCTGAGGGGGTAATCGCATTCTTGATATTGGCTAAACCAAAGGAAACGTTCCT
    TCAATCACCCCCCATTCGAGAGGCAGCAAACTACACTGAAAATACATCAAGTTACTATGCCACATCCTAC
    TTGGAGTACGAAATCGAAAATTTTGGTGCTCAACACTCCACGACCCTTTTCAAAATTAACAATAATACTT
    TTGTTCTTCTGGACAGGCCCCACACGCCTCAGTTCCTTTTCCAGCTGAATGATACCATTCAACTTCACCA
    ACAGTTGAGCAACACAACTGGGAAACTAATTTGGACACTAGATGCTAATATCAATGCTGATATTGGTGAA
    TGGGCTTTTTGGGAAAATAAAAAAATCTCTCCGAACAACTACGTGGAGAAGAGCTGTCTTTCGAAACTTT
    ATCGCTCAACGAGACAGAAGACGATGATGCGACATCGTCGAGAACTACAAAGGGAAGAATCTCCGACCGG
    GCCACCAGGAAGTATTCGGACCTGGTTCCAAAGGATTCCCCTGGGATGGTTTCATTGCACGTACCAGAAG
    GGGAAACAACATTGCCGTCTCAGAATTCGACAGAAGGTCGAAGAGTAGATGTGAATACTCAGGAAACTAT
    CACAGAGACAACTGCAACAATCATAGGCACTAACGGTAACAACATGCAGATCTCCACCATCGGGACAGGA
    CTGAGCTCCAGCCAAATCCTGAGTTCCTCACCGACCATGGCACCAAGCCCTGAGACTCAGACCTCCACAA
    CCTACACACCAAAACTACCAGTGATGACCACCGAGGAATCAACAACACCACCGAGAAACTCTCCTGGCTC
    AACAACAGAAGCACCCACTCTCACCACCCCAGAGAATATAACAACAGCGGTTAAAACTGTTTGGCCACAA
    GAGTCCACAAGCAACGGTCTAATAACTTCAACAGTAACAGGGATTCTTGGGAGCCTTGGACTTCGAAAAC
    GCAGCAGAAGACAAGTTAACACCAGGGCCACGGGTAAATGCAATCCCAACTTACACTACTGGACTGCACA
    AGAACAACATAATGCTGCTGGGATTGCCTGGATCCCGTACTTTGGACCGGGTGCAGAAGGCATATACACT
    GAAGGCCTTATGCACAACCAAAATGCCTTAGTCTGTGGACTCAGACAACTTGCAAATGAAACAACTCAAG
    CTCTGCAGCTTTTCTTAAGGGCCACGACGGAGCTGCGGACATATACCATACTCAATAGGAAGGCCATAGA
    TTTCCTTCTGCGACGATGGGGCGGGACATGTAGGATCCTGGGACCAGATTGTTGCATTGAGCCACATGAT
    TGGACCAAAAACATCACTGATAAAATCAACCAAATCATCCATGATTTCATCGACAACCCTTTACCCAATC
    AGGATAATGATGATAATTGGTGGACGGGCTGGAGACAGTGGATCCCTGCAGGAATAGGCATTACTGGAAT
    TATTATTGCAATCATTGCTCTTCTTTGCGTCTGCAAGCTGCTTTGTTGAATATCAACTTGAATCATTAAT
    TTAAAGTTGATACATTTCTAACATTATAAATTATAATCTGATATTAATACTTGAAAATAAGGCTAATGCC
    AAATTCTGTGCCAAACTTGAAAGTAGGTTTACCAAAATCCTTTGAACTGGAATGCTTTAATGCTCTTTCT
    CAATACTATATAAGTTCCTTCCCAAAATAATATTGATGAAGATTAAGAAAAA
  • Protein Sequence : Show Sequence
    >AAB37096.1 virion spike glycoprotein precursor [Sudan ebolavirus]
    MEGLSLLQLPRDKFRKSSFFVWVIILFQKAFSMPLGVVTNSTLEVTEIDQLVCKDHLASTDQLKSVGLNL
    EGSGVSTDIPSATKRWGFRSGVPPQVVSYEAGEWAENCYNLEIKKPDGSECLPPPPDGVRGFPRCRYVHK
    AQGTGPCPGDYAFHKDGAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPKETFLQSPPIREAANYTENTS
    SYYATSYLEYEIENFGAQHSTTLFKINNNTFVLLDRPHTPQFLFQLNDTIQLHQQLSNTTGKLIWTLDAN
    INADIGEWAFWENKKNLSEQLRGEELSFETLSLNETEDDDATSSRTTKGRISDRATRKYSDLVPKDSPGM
    VSLHVPEGETTLPSQNSTEGRRVDVNTQETITETTATIIGTNGNNMQISTIGTGLSSSQILSSSPTMAPS
    PETQTSTTYTPKLPVMTTEESTTPPRNSPGSTTEAPTLTTPENITTAVKTVWPQESTSNGLITSTVTGIL
    GSLGLRKRSRRQVNTRATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQ
    LANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDF
    IDNPLPNQDNDDNWWTGWRQWIPAGIGITGIIIAIIALLCVCKLLC
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.616
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
8. VP24
  • Gene Name : VP24
  • Sequence Strain (Species/Organism) : Ebola virus
  • NCBI Protein GI : SCD11538
  • Other Database IDs : CDD:283933
  • Taxonomy ID : 1570291
  • Protein Name : VP24
  • Protein pI : 9.73
  • Protein Weight : 27754.06
  • Protein Length : 287
  • Protein Note : monopartite
  • Protein Sequence : Show Sequence
    >SCD11538.1 VP24 [Ebola virus]
    MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAPAWS
    MTRNLFPHLFQNPNSTIESPLWALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQR
    VKEQLSLKMLSLIRSNILKFINKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMN
    RKKPGPAKFSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation :
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.303
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
9. VP24 from Reston ebolavirus
  • Gene Name : VP24 from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010860
  • NCBI Gene ID : 955193
  • NCBI Protein GI : 22789228
  • Locus Tag : REBOVgp7
  • Genbank Accession : AF522874
  • Protein Accession : NP_690586
  • Taxonomy ID : 186539
  • Gene Starting Position : 9831
  • Gene Ending Position : 11480
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 10.16
  • Protein Weight : 26779.18
  • Protein Length : 251
  • DNA Sequence : Show Sequence
    >NC_004161.1:9831-11480 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    GGATGAAGATTAATTGCGGAGGAATCAGGAATTCAACTTTAGTTCCTTAAGGCCTCGTCCGAATCTTCAT
    CAGTTCGTAAGTTCTTTTATAGAAGTCATTAGCTTCTAAGGTGATTATATTTTAGTATTAAATTTTGCTA
    ATTGCTTGCTATAAAGTTGAAATGTCTAATGCTTAAATGAACACTTTTTTGAAGCTGACATACGAATACA
    TCATATCATATGAAAACATCGCAATTAGAGCGTCCTTGAAGTCTGGCATTGACAGTCACCAGGCTGTTCT
    CAGTAGTCTGTCCTTGGAAGCTCTTGGGGAGACAAAAAGAGGTCCCAGAGAGTCCCAACAGGTTGGCATA
    AGGTCATTAACACCAGCATAGTCGGCTCGACCAAGACTGTAAGCGAGTCGATTTCAACTAAAAAGATTAT
    TTCTTGTTGTTTAAACAAATTCCTTTTGTGTGAGACATCCTCAAGGCACAAGATGGCTAAAGCCACAGGC
    CGATACAATCTCGTGCCCCCAAAGAAAGATATGGAAAAGGGAGTGATTTTTAGTGATCTTTGTAATTTCT
    TGATTACTCAAACCCTGCAAGGTTGGAAGGTTTATTGGGCAGGAATTGAGTTTGATGTAAGTCAAAAAGG
    CATGGCTCTTCTGACAAGACTCAAAACAAATGACTTTGCTCCTGCCTGGGCGATGACAAGAAATCTTTTC
    CCACATCTGTTCCAGAACCCAAATTCGGTTATTCAATCTCCCATCTGGGCTTTGAGGGTAATTTTGGCAG
    CCGGATTGCAGGATCAGTTGTTAGACCATTCATTGGTTGAGCCATTGACAGGGGCTCTCGGTCTAATTTC
    TGATTGGCTCCTAACTACAACGTCAACACATTTCAATCTTCGTACTAGAAGCGTAAAGGACCAGCTTAGT
    CTTCGTATGTTATCTTTGATCAGGTCAAACATCTTGCAGTTCATCAACAAGCTTGACGCCCTGCATGTTG
    TCAATTACAATGGTTTACTCAGTAGTATTGAGATCGGGACTTCTACACACACAATCATTATAACTCGTAC
    AAATATGGGTTTTCTCGTGGAAGTTCAAGAGCCTGACAAATCAGCTATGAATTCTAAGCGCCCAGGACCA
    GTCAAGTTCTCATTACTTCATGAGTCTGCCTTCAAACCTTTCACTCGTGTTCCACAATCTGGGATGCAAT
    CATTAATAATGGAGTTCAACAGTTTGTTGGCAATTTAACAAGGTAATCTTAAAATAAGTACATGAATGAG
    AATTAGTTGTGGGTCTTATCTAGCATTGTTGAGTTAACTATCTAATCTATTTTCGCTAATTGCATTGAGC
    ACTGCTAATAGGTTTGTATCACGTTAAAGATTTAGAGTGTATGAATTGTGCAGATTTAAACTTGGGTTTT
    GCCTTATGCTTCATAGGTGGTCTTTTTGAAATGGAGATTATCAGCATTTCTTAAATGGGAGGAGTTAGCA
    ATCAGAAATTGGAGATAAATGGACATCGGGATAGAACAATGCCTAACTATTGGGCGGCTTCCATTTTTAC
    ATGTGTATATAACCAATCTTTTCCTATCTTTGCTTATATTGGTGTAACTTTATTTTAATAACATGTCAAT
    GCTATACTGTTAAGAGAAGGTCTGAGGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690586.1 membrane-associated protein [Reston ebolavirus]
    MAKATGRYNLVPPKKDMEKGVIFSDLCNFLITQTLQGWKVYWAGIEFDVSQKGMALLTRLKTNDFAPAWA
    MTRNLFPHLFQNPNSVIQSPIWALRVILAAGLQDQLLDHSLVEPLTGALGLISDWLLTTTSTHFNLRTRS
    VKDQLSLRMLSLIRSNILQFINKLDALHVVNYNGLLSSIEIGTSTHTIIITRTNMGFLVEVQEPDKSAMN
    SKRPGPVKFSLLHESAFKPFTRVPQSGMQSLIMEFNSLLAI
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.352
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
10. VP24 from Zaire ebolavirus
  • Gene Name : VP24 from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010866
  • NCBI Gene ID : 911828
  • NCBI Protein GI : 10313998
  • Locus Tag : ZEBOVgp6
  • Genbank Accession : AY142960
  • Protein Accession : NP_066250
  • Taxonomy ID : 186538
  • Gene Starting Position : 9884
  • Gene Ending Position : 11517
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 10.1
  • Protein Weight : 27225.61
  • Protein Length : 251
  • DNA Sequence : Show Sequence
    >NC_002549.1:9884-11517 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGATGAAGATTAATGCGGAGGTCTGATAAGAATAAACCTTATTATTCAGATTAGGCCCCAAGAGGCATTC
    TTCATCTCCTTTTAGCAAAGTACTATTTCAGGGTAGTCCAATTAGTGGCACGTCTTTTAGCTGTATATCA
    GTCGCCCCTGAGATACGCCACAAAAGTGTCTCTAAGCTAAATTGGTCTGTACACATCCCATACATTGTAT
    TAGGGGCAATAATATCTAATTGAACTTAGCCGTTTAAAATTTAGTGCATAAATCTGGGCTAACACCACCA
    GGTCAACTCCATTGGCTGAAAAGAAGCTTACCTACAACGAACATCACTTTGAGCGCCCTCACAATTAAAA
    AATAGGAACGTCGTTCCAACAATCGAGCGCAAGGTTTCAAGGTTGAACTGAGAGTGTCTAGACAACAAAA
    TATTGATACTCCAGACACCAAGCAAGACCTGAGAAAAAACCATGGCTAAAGCTACGGGACGATACAATCT
    AATATCGCCCAAAAAGGACCTGGAGAAAGGGGTTGTCTTAAGCGACCTCTGTAACTTCTTAGTTAGCCAA
    ACTATTCAGGGGTGGAAGGTTTATTGGGCTGGTATTGAGTTTGATGTGACTCACAAAGGAATGGCCCTAT
    TGCATAGACTGAAAACTAATGACTTTGCCCCTGCATGGTCAATGACAAGGAATCTCTTTCCTCATTTATT
    TCAAAATCCGAATTCCACAATTGAATCACCGCTGTGGGCATTGAGAGTCATCCTTGCAGCAGGGATACAG
    GACCAGCTGATTGACCAGTCTTTGATTGAACCCTTAGCAGGAGCCCTTGGTCTGATCTCTGATTGGCTGC
    TAACAACCAACACTAACCATTTCAACATGCGAACACAACGTGTCAAGGAACAATTGAGCCTAAAAATGCT
    GTCGTTGATTCGATCCAATATTCTCAAGTTTATTAACAAATTGGATGCTCTACATGTCGTGAACTACAAC
    GGATTGTTGAGCAGTATTGAAATTGGAACTCAAAATCATACAATCATCATAACTCGAACTAACATGGGTT
    TTCTGGTGGAGCTCCAAGAACCCGACAAATCGGCAATGAACCGCATGAAGCCTGGGCCGGCGAAATTTTC
    CCTCCTTCATGAGTCCACACTGAAAGCATTTACACAAGGATCCTCGACACGAATGCAAAGTTTGATTCTT
    GAATTTAATAGCTCTCTTGCTATCTAACTAAGGTAGAATACTTCATATTGAGCTAACTCATATATGCTGA
    CTCAATAGTTATCTTGACATCTCTGCTTTCATAATCAGATATATAAGCATAATAAATAAATACTCATATT
    TCTTGATAATTTGTTTAACCACAGATAAATCCTCACTGTAAGCCAGCTTCCAAGTTGACACCCTTACAAA
    AACCAGGACTCAGAATCCCTCAAACAAGAGATTCCAAGACAACATCATAGAATTGCTTTATTATATGAAT
    AAGCATTTTATCACCAGAAATCCTATATACTAAATGGTTAATTGTAACTGAACCCGCAGGTCACATGTGT
    TAGGTTTCACAGATTCTATATATTACTAACTCTATACTCGTAATTAACATTAGATAAGTAGATTAAGAAA
    AAAGCCTGAGGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066250.1 membrane-associated protein [Zaire ebolavirus]
    MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAPAWS
    MTRNLFPHLFQNPNSTIESPLWALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQR
    VKEQLSLKMLSLIRSNILKFINKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMN
    RMKPGPAKFSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : VP24 expressed from alphavirus replicons induced a protective immune response in BALB/c mice when challenged with Ebola virus Zaire (Wilson et al., 2001).
  • Additional Molecule Role : Protective antigen
  • Related Vaccine(s): VRP expressing VP24
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.318
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
11. VP30
  • Gene Name : VP30
  • Sequence Strain (Species/Organism) : Ebola virus
  • NCBI Protein GI : SCD11537
  • Other Database IDs : CDD:314419
  • Taxonomy ID : 1570291
  • Protein Name : VP30
  • Protein pI : 7.74
  • Protein Weight : 31662.28
  • Protein Length : 325
  • Protein Note : monopartite
  • Protein Sequence : Show Sequence
    >SCD11537.1 VP30 [Ebola virus]
    MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRSASQVRVPTVFHKKRVEPLTVPPAPKD
    ICPTLKKGFLCDSSFCKKDHQLESLTDRELLLLIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGP
    KITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEV
    YQRLHSDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTNPGTC
    SWSDEGTP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation :
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.178
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
12. VP30 from Reston ebolavirus
  • Gene Name : VP30 from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010862
  • NCBI Gene ID : 955196
  • NCBI Protein GI : 22789227
  • Locus Tag : REBOVgp6
  • Genbank Accession : AF522874
  • Protein Accession : NP_690585
  • Taxonomy ID : 186539
  • Gene Starting Position : 8261
  • Gene Ending Position : 9700
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 8.3
  • Protein Weight : 31307.9
  • Protein Length : 287
  • DNA Sequence : Show Sequence
    >NC_004161.1:8261-9700 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    TGACGAAGATTAAAGGAGAGGATCGTTAACGGGAAAACCTCCCATCTCGTTCGTCGAAGCCACGTTGGTG
    GTGCTTGCAGCTGAGAACAACTCCAGAGATTGTAGGTAGAAAGGACCAACATTTATAGGTAGGGGTCAGA
    AAGCAACAATAACCATAAAAGGAGAGCCTGACATTGCTATTTAATATCCTAGAACCTGATTTCTAGGTTC
    TAGCTTTAAAATCCGGATGATGGAGCATTCAAGAGAACGGGGTAGATCTAGCAACATGCGACATAATAGC
    CGGGAACCATACGAAAATCCATCAAGGTCTCGCTCATTATCTCGGGACCCTAATCAGGTTGATCGTAGAC
    AGCCTCGAAGTGCATCCCAAATTCGTGTTCCGAATCTGTTCCATCGGAAAAAGACTGATGCACTCATAGT
    TCCTCCGGCTCCTAAAGATATATGCCCAACACTCAAAAAAGGATTCCTCTGCGATAGCAAATTTTGCAAA
    AAAGATCACCAATTGGATAGCTTAAATGATCATGAATTACTACTGCTAATTGCAAGAAGAACATGTGGAA
    TTATCGAGAGCAATTCGCAGATTACATCCCCAAAAGATATGCGGTTAGCGAATCCAACAGCTGAAGACTT
    CTCACAAGGTAATAGTCCTAAATTAACACTTGCAGTCCTTCTTCAAATTGCTGAACATTGGGCAACCAGA
    GACCTAAGGCAAATTGAGGACTCTAAACTTAGAGCTCTTTTAACCCTTTGTGCCGTATTAACAAGGAAAT
    TTTCTAAATCCCAACTGGGTCTTCTATGTGAGACCCACCTACGGCATGAGGGCCTCGGACAGGACCAAGC
    TGATTCTGTATTAGAGGTCTACCAAAGACTCCACAGTGATAAAGGAGGGAATTTTGAGGCTGCCCTGTGG
    CAACAATGGGACCGACAGTCATTAATAATGTTCATCTCTGCTTTTCTCAACATTGCTCTCCAGATACCTT
    GTGAAAGTTCTAGTGTCGTAGTCTCAGGTCTTGCCACATTGTACCCAGCACAAGACAATTCTACACCATC
    CGAGGCAACTAATGATACCACCTGGTCAAGTACAGTTGAATAGAAAACCACTGGAGCTATTTTTCCACGA
    TTGCTCTCAGTCAATAAATTAATATAGATATAATACGACTTCGGTGTGCAATTGTCAAGAGTTCCATTTA
    GTAATAATGATTCTTAAAACAATCTACTATCGCAATTATCGATGGATCTACCCTATTTGACGGTACATGA
    CTTGAATGTAATAAGGTAAGTTGGTATCTGAGGTATTTTGTCTAGAGTATACTCAAAATCGTATGTCTAG
    CAAATTATCAATAGCAAAGTTAAATTCTCCTAACCTCATATTTTGATCAAGTAATCATGATTTTATGATA
    ATTCTTTTCAGATTATCGGTTTAATCTTTATTAAGAAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690585.1 minor nucleoprotein [Reston ebolavirus]
    MEHSRERGRSSNMRHNSREPYENPSRSRSLSRDPNQVDRRQPRSASQIRVPNLFHRKKTDALIVPPAPKD
    ICPTLKKGFLCDSKFCKKDHQLDSLNDHELLLLIARRTCGIIESNSQITSPKDMRLANPTAEDFSQGNSP
    KLTLAVLLQIAEHWATRDLRQIEDSKLRALLTLCAVLTRKFSKSQLGLLCETHLRHEGLGQDQADSVLEV
    YQRLHSDKGGNFEAALWQQWDRQSLIMFISAFLNIALQIPCESSSVVVSGLATLYPAQDNSTPSEATNDT
    TWSSTVE
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.148
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
13. VP30 from Zaire ebolavirus
  • Gene Name : VP30 from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010867
  • NCBI Gene ID : 911826
  • NCBI Protein GI : 10313997
  • Locus Tag : ZEBOVgp5
  • Genbank Accession : AF272001
  • Protein Accession : NP_066249
  • 3D structure: PDB ID : 2I8B
  • Taxonomy ID : 186538
  • Gene Starting Position : 8287
  • Gene Ending Position : 9739
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 8.23
  • Protein Weight : 31130.81
  • Protein Length : 288
  • DNA Sequence : Show Sequence
    >NC_002549.1:8287-9739 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGATGAAGATTAAGAAAAAGGTAATCTTTCGATTATCTTTAATCTTCATCCTTGATTCTACAATCATGAC
    AGTTGTCTTTAGTGACAAGGGAAAGAAGCCTTTTTATTAAGTTGTAATAATCAGATCTGCGAACCGGTAG
    AGTTTAGTTGCAACCTAACACACATAAAGCATTGGTCAAAAAGTCAATAGAAATTTAAACAGTGAGTGGA
    GACAACTTTTAAATGGAAGCTTCATATGAGAGAGGACGCCCACGAGCTGCCAGACAGCATTCAAGGGATG
    GACACGACCACCATGTTCGAGCACGATCATCATCCAGAGAGAATTATCGAGGTGAGTACCGTCAATCAAG
    GAGCGCCTCACAAGTGCGCGTTCCTACTGTATTTCATAAGAAGAGAGTTGAACCATTAACAGTTCCTCCA
    GCACCTAAAGACATATGTCCGACCTTGAAAAAAGGATTTTTGTGTGACAGTAGTTTTTGCAAAAAAGATC
    ACCAGTTGGAGAGTTTAACTGATAGGGAATTACTCCTACTAATCGCCCGTAAGACTTGTGGATCAGTAGA
    ACAACAATTAAATATAACTGCACCCAAGGACTCGCGCTTAGCAAATCCAACGGCTGATGATTTCCAGCAA
    GAGGAAGGTCCAAAAATTACCTTGTTGACACTGATCAAGACGGCAGAACACTGGGCGAGACAAGACATCA
    GAACCATAGAGGATTCAAAATTAAGAGCATTGTTGACTCTATGTGCTGTGATGACGAGGAAATTCTCAAA
    ATCCCAGCTGAGTCTTTTATGTGAGACACACCTAAGGCGCGAGGGGCTTGGGCAAGATCAGGCAGAACCC
    GTTCTCGAAGTATATCAACGATTACACAGTGATAAAGGAGGCAGTTTTGAAGCTGCACTATGGCAACAAT
    GGGACCGACAATCCCTAATTATGTTTATCACTGCATTCTTGAATATTGCTCTCCAGTTACCGTGTGAAAG
    TTCTGCTGTCGTTGTTTCAGGGTTAAGAACATTGGTTCCTCAATCAGATAATGAGGAAGCTTCAACCAAC
    CCGGGGACATGCTCATGGTCTGATGAGGGTACCCCTTAATAAGGCTGACTAAAACACTATATAACCTTCT
    ACTTGATCACAATACTCCGTATACCTATCATCATATATTTAATCAAGACGATATCCTTTAAAACTTATTC
    AGTACTATAATCACTCTCGTTTCAAATTAATAAGATGTGCATGATTGCCCTAATATATGAAGAGGTATGA
    TACAACCCTAACAGTGATCAAAGAAAATCATAATCTCGTATCGCTCGTAATATAACCTGCCAAGCATACC
    TCTTGCACAAAGTGATTCTTGTACACAAATAATGTTTTACTCTACAGGAGGTAGCAACGATCCATCCCAT
    CAAAAAATAAGTATTTCATGACTTACTAATGATCTCTTAAAATATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066249.1 minor nucleoprotein [Zaire ebolavirus]
    MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRSASQVRVPTVFHKKRVEPLTVPPAPKD
    ICPTLKKGFLCDSSFCKKDHQLESLTDRELLLLIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGP
    KITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEV
    YQRLHSDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTNPGTC
    SWSDEGTP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : VP30 expressed from alphavirus replicons induced a protective immune response in BALB/c mice when challenged with Ebola virus Zaire (Wilson et al., 2001).
  • Additional Molecule Role : Protective antigen
  • Related Vaccine(s): VRP expressing VP30
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.178
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
14. VP35
  • Gene Name : VP35
  • Sequence Strain (Species/Organism) : Ebola virus
  • NCBI Protein GI : SCD11532
  • Other Database IDs : CDD:280298
  • Taxonomy ID : 1570291
  • Protein Name : VP35
  • Protein pI : 5.92
  • Protein Weight : 36093.95
  • Protein Length : 377
  • Protein Note : monopartite
  • Protein Sequence : Show Sequence
    >SCD11532.1 VP35 [Ebola virus]
    MTTRTKGRGHTVATTQNDRMPGPELSGWISEQLMTGRIPVNDIFCDIENNPGLCYASQMQQTKPNPKMRN
    SQTQTDPICNHSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVA
    KYDLLVMTTGRATATAAATEAYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLDSTTSLT
    EENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQI
    TKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation :
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.460
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
15. VP35 from Reston ebolavirus
  • Gene Name : VP35 from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010863
  • NCBI Gene ID : 955189
  • NCBI Protein GI : 22789224
  • Locus Tag : REBOVgp2
  • Genbank Accession : AF522874
  • Protein Accession : NP_690581
  • Taxonomy ID : 186539
  • Gene Starting Position : 3018
  • Gene Ending Position : 4412
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 7.39
  • Protein Weight : 34622.88
  • Protein Length : 329
  • DNA Sequence : Show Sequence
    >NC_004161.1:3018-4412 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    TGATGAAGATTAAAACCTTCATCGCCAGTAAATGATTATATTGTCTGTAGGCAGGTGTTTACTCCACCTT
    AAATTTGGAAATATCCTACCTTAGGACCATTGTCAAGAGGTGCATAGGCATTACCACCCTTGAGAACATG
    TACAATAATAAATTGAAGGTATGTTCAGGCCCAGAAACGACTGGATGGATTTCTGAGCAACTTATGACAG
    GTAAGATTCCAGTAACTGATATATTCATTGATATTGATAACAAGCCAGATCAAATGGAAGTCCGACTCAA
    ACCATCATCAAGGAGCTCAACAAGAACTTGTACAAGTAGCAGTCAGACGGAGGTCAACTATGTACCTCTC
    CTTAAAAAGGTTGAGGATACATTAACTATGCTAGTGAATGCCACCAGTCGTCAGAATGCTGCAATCGAGG
    CCCTTGAAAACCGCCTCAGCACACTTGAGAGTAGCTTAAAGCCAATCCAAGACATGGGTAAAGTGATTTC
    ATCATTGAATCGCAGTTGTGCCGAAATGGTTGCAAAATATGATCTTCTAGTTATGACAACTGGACGGGCT
    ACTTCAACTGCAGCTGCAGTAGATGCGTATTGGAAAGAGCACAAACAGCCACCACCAGGGCCAGCGTTGT
    ATGAAGAGAATGCGCTTAAAGGAAAAATCGATGATCCAAACAGCTATGTACCAGATGCTGTGCAAGAGGC
    TTACAAGAACCTTGACAGTACATCGACCCTGACCGAGGAAAATTTTGGGAAACCTTATATATCTGCTAAA
    GACCTGAAGGAGATCATGTATGATCATCTACCTGGTTTTGGGACTGCCTTTCACCAACTTGTTCAAGTGA
    TTTGTAAAATAGGAAAGGATAACAACCTTTTGGACACAATCCATGCTGAGTTCCAGGCAAGTCTAGCAGA
    TGGTGACTCTCCCCAATGTGCACTCATACAGATAACCAAAAGGGTCCCAATCTTTCAGGATGTGCCGCCC
    CCGATAATCCATATTAGATCCCGTGGTGACATCCCACGAGCATGCCAAAAGAGTCTCCGACCAGCACCAC
    CATCACCCAAAATTGATCGTGGTTGGGTTTGTTTGTTTAAGATGCAAGATGGTAAAACGCTTGGACTTAA
    GATCTAAGAATCAAGATTTATTTAACAAGGCAAGCCACAACCTTAGATGGAACCTCAGCCAGACTATTGA
    ACTATTGACGCTGTTGATGATAATATATAATTAATGGTCTTATTTGAATATGACAACATCTTGCTTCTTG
    TTCTGCCTTGTAGCTCTTTGAATTGGAAGATCATTCCAAACTTACAAACATGCACAAGATGTTATGGTTT
    AGCAAAGAATTGATAGGAGTACTGGTATATAATGTAAATATAACAAGTGATGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690581.1 polymerase complex protein [Reston ebolavirus]
    MYNNKLKVCSGPETTGWISEQLMTGKIPVTDIFIDIDNKPDQMEVRLKPSSRSSTRTCTSSSQTEVNYVP
    LLKKVEDTLTMLVNATSRQNAAIEALENRLSTLESSLKPIQDMGKVISSLNRSCAEMVAKYDLLVMTTGR
    ATSTAAAVDAYWKEHKQPPPGPALYEENALKGKIDDPNSYVPDAVQEAYKNLDSTSTLTEENFGKPYISA
    KDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVP
    PPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.477
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
16. VP35 from Zaire ebolavirus
  • Gene Name : VP35 from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010864
  • NCBI Gene ID : 911827
  • NCBI Protein GI : 10313992
  • Locus Tag : ZEBOVgp2
  • Genbank Accession : AF272001
  • Protein Accession : NP_066244
  • 3D structure: PDB ID : 3FKE
  • Taxonomy ID : 186538
  • Gene Starting Position : 3031
  • Gene Ending Position : 4406
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 6.62
  • Protein Weight : 35575.45
  • Protein Length : 340
  • DNA Sequence : Show Sequence
    >NC_002549.1:3031-4406 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGATGAAGATTAAAACCTTCATCATCCTTACGTCAATTGAATTCTCTAGCACTCGAAGCTTATTGTCTTC
    AATGTAAAAGAAAAGCTGGTCTAACAAGATGACAACTAGAACAAAGGGCAGGGGCCATACTGCGGCCACG
    ACTCAAAACGACAGAATGCCAGGCCCTGAGCTTTCGGGCTGGATCTCTGAGCAGCTAATGACCGGAAGAA
    TTCCTGTAAGCGACATCTTCTGTGATATTGAGAACAATCCAGGATTATGCTACGCATCCCAAATGCAACA
    AACGAAGCCAAACCCGAAGACGCGCAACAGTCAAACCCAAACGGACCCAATTTGCAATCATAGTTTTGAG
    GAGGTAGTACAAACATTGGCTTCATTGGCTACTGTTGTGCAACAACAAACCATCGCATCAGAATCATTAG
    AACAACGCATTACGAGTCTTGAGAATGGTCTAAAGCCAGTTTATGATATGGCAAAAACAATCTCCTCATT
    GAACAGGGTTTGTGCTGAGATGGTTGCAAAATATGATCTTCTGGTGATGACAACCGGTCGGGCAACAGCA
    ACCGCTGCGGCAACTGAGGCTTATTGGGCCGAACATGGTCAACCACCACCTGGACCATCACTTTATGAAG
    AAAGTGCGATTCGGGGTAAGATTGAATCTAGAGATGAGACCGTCCCTCAAAGTGTTAGGGAGGCATTCAA
    CAATCTAAACAGTACCACTTCACTAACTGAGGAAAATTTTGGGAAACCTGACATTTCGGCAAAGGATTTG
    AGAAACATTATGTATGATCACTTGCCTGGTTTTGGAACTGCTTTCCACCAATTAGTACAAGTGATTTGTA
    AATTGGGAAAAGATAGCAACTCATTGGACATCATTCATGCTGAGTTCCAGGCCAGCCTGGCTGAAGGAGA
    CTCTCCTCAATGTGCCCTAATTCAAATTACAAAAAGAGTTCCAATCTTCCAAGATGCTGCTCCACCTGTC
    ATCCACATCCGCTCTCGAGGTGACATTCCCCGAGCTTGCCAGAAAAGCTTGCGTCCAGTCCCACCATCGC
    CCAAGATTGATCGAGGTTGGGTATGTGTTTTTCAGCTTCAAGATGGTAAAACACTTGGACTCAAAATTTG
    AGCCAATCTCCCTTCCCTCCGAAAGAGGCGAATAATAGCAGAGGCTTCAACTGCTGAACTATAGGGTACG
    TTACATTAATGATACACTTGTGAGTATCAGCCCTGGATAATATAAGTCAATTAAACGACCAAGATAAAAT
    TGTTCATATCTCGCTAGCAGCTTAAAATATAAATGTAATAGGAGCTATATCTCTGACAGTATTATAATCA
    ATTGTTATTAAGTAACCCAAACCAAAAGTGATGAAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066244.1 polymerase complex protein [Zaire ebolavirus]
    MTTRTKGRGHTAATTQNDRMPGPELSGWISEQLMTGRIPVSDIFCDIENNPGLCYASQMQQTKPNPKTRN
    SQTQTDPICNHSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVA
    KYDLLVMTTGRATATAAATEAYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLNSTTSLT
    EENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQI
    TKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : VP35 expressed from alphavirus replicons induced a protective immune response in C57BL/6 mice when challenged with Ebola virus Zaire (Wilson et al., 2001).
  • Additional Molecule Role : Protective antigen
  • Related Vaccine(s): VRP expressing VP35
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.483
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
17. VP40 from Reston ebolavirus
  • Gene Name : VP40 from Reston ebolavirus
  • Sequence Strain (Species/Organism) : Reston ebolavirus
  • VO ID : VO_0010861
  • NCBI Gene ID : 955192
  • NCBI Protein GI : 22789225
  • Locus Tag : REBOVgp3
  • Genbank Accession : AF522874
  • Protein Accession : NP_690582
  • 3D structure: PDB ID : 1ES6
  • Taxonomy ID : 186539
  • Gene Starting Position : 4395
  • Gene Ending Position : 5892
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 8.98
  • Protein Weight : 33340.06
  • Protein Length : 331
  • DNA Sequence : Show Sequence
    >NC_004161.1:4395-5892 Reston ebolavirus isolate Reston virus/M.fascicularis-tc/USA/1989/Philippines89-Pennsylvania, complete genome
    TGATGAAGATTAAGAAAAACCAGTCGGTATTTTCCAGACTTGGCATTTCTTATCTTCATCTTCTAAAGTG
    AGATATTTTATCATCAAAAAATGAGGCGCGGAGTGTTACCAACGGCTCCTCCAGCATATAATGATATTGC
    ATACCCTATGAGCATACTCCCAACCCGACCAAGTGTCATAGTCAATGAGACCAAATCAGATGTACTGGCA
    GTGCCAGGGGCAGATGTTCCATCAAACTCCATGAGACCAGTGGCTGATGATAACATTGATCACTCAAGCC
    ATACTCCAAGCGGAGTAGCTTCTGCCTTTATATTGGAAGCTACAGTGAATGTAATTTCGGGAACAAAAGT
    CCTGATGAAGCAAATACCTATTTGGCTTCCACTGGGTGTAGCTGATCAGAAGATATACAGCTTTGATTCA
    ACAACAGCCGCAATTATGTTGGCTTCCTACACAGTGACACACTTCGGGAAGATATCTAACCCGCTGGTAC
    GTGTCAACAGGCTAGGCCCAGGAATACCCGATCATCCGCTACGACTCCTAAGGTTGGGCAATCAGGCATT
    CCTTCAAGAGTTTGTTCTTCCACCAGTCCAGCTTCCCCAGTATTTCACATTTGATCTAACAGCTCTAAAG
    CTCATCACTCAACCATTGCCAGCTGCAACCTGGACAGACGAAACTCCAGCAGGAGCAGTCAATGCTCTTC
    GTCCTGGGCTCTCACTCCATCCCAAGCTTCGTCCAATTCTCCTGCCGGGGAAGACAGGAAAGAAAGGACA
    TGCTTCAGACTTAACATCACCTGACAAGATTCAAACAATCATGAATGCAATACCGGACCTCAAAATTGTC
    CCGATTGATCCAACCAAGAACATAGTTGGAATTGAGGTTCCAGAATTACTAGTTCAAAGGCTGACCGGCA
    AAAAACCACAACCCAAAAATGGCCAACCAATTATTCCAGTTCTTCTTCCGAAATATGTTGGACTTGATCC
    TATATCGCCAGGGGACTTAACTATGGTTATCACCCAGGATTGTGATTCATGCCACTCTCCAGCCAGCCAT
    CCGTATCACATGGACAAGCAGAATAGTTACCAATAATTTAAATTCCATTCGAGCTATTATTCTGCTAGTA
    ATTCCGACGGGATCAATAGACTAAAAATCTGATTGTATAGAATTATAAAAGAATCAAGCAGAGGCAACAG
    ACTCACAGCTTACGCCTAGATAACTAATATTAAGGAGTTTTTTAATCTAATTTTCCAGTCTTGAGTAATA
    ATCATTTCTTTTGTAATTAATTATGCATTTGTTAACTTATCGGTGCGAGATTTCCTTGAGAACCCGGCGG
    AGCTTCTACTATCTGCAGTAACCAGAAGAGAAGTTCAACCCAGTCAAAACTAAACCAAGCAATATTCTGA
    ATGCTCTATAGTCTATTCTAATCAGAGGTATAACAATGGCTAAGATTTCAATGACTCGTTAACAATCGCT
    AGTAATTTTAATCTCCAGATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_690582.1 matrix protein [Reston ebolavirus]
    MRRGVLPTAPPAYNDIAYPMSILPTRPSVIVNETKSDVLAVPGADVPSNSMRPVADDNIDHSSHTPSGVA
    SAFILEATVNVISGTKVLMKQIPIWLPLGVADQKIYSFDSTTAAIMLASYTVTHFGKISNPLVRVNRLGP
    GIPDHPLRLLRLGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDETPAGAVNALRPGLSLH
    PKLRPILLPGKTGKKGHASDLTSPDKIQTIMNAIPDLKIVPIDPTKNIVGIEVPELLVQRLTGKKPQPKN
    GQPIIPVLLPKYVGLDPISPGDLTMVITQDCDSCHSPASHPYHMDKQNSYQ
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.291
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
18. VP40 from Zaire ebolavirus
  • Gene Name : VP40 from Zaire ebolavirus
  • Sequence Strain (Species/Organism) : Zaire ebolavirus
  • VO ID : VO_0010868
  • NCBI Gene ID : 911825
  • NCBI Protein GI : 10313993
  • Locus Tag : ZEBOVgp3
  • Genbank Accession : AF272001
  • Protein Accession : NP_066245
  • 3D structure: PDB ID : 1ES6
  • Taxonomy ID : 186538
  • Gene Starting Position : 4389
  • Gene Ending Position : 5893
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 9.02
  • Protein Weight : 33197.88
  • Protein Length : 326
  • DNA Sequence : Show Sequence
    >NC_002549.1:4389-5893 Zaire ebolavirus isolate Ebola virus/H.sapiens-tc/COD/1976/Yambuku-Mayinga, complete genome
    TGATGAAGATTAAGAAAAACCTACCTCGGCTGAGAGAGTGTTTTTTCATTAACCTTCATCTTGTAAACGT
    TGAGCAAAATTGTTAAAAATATGAGGCGGGTTATATTGCCTACTGCTCCTCCTGAATATATGGAGGCCAT
    ATACCCTGTCAGGTCAAATTCAACAATTGCTAGAGGTGGCAACAGCAATACAGGCTTCCTGACACCGGAG
    TCAGTCAATGGGGACACTCCATCGAATCCACTCAGGCCAATTGCCGATGACACCATCGACCATGCCAGCC
    ACACACCAGGCAGTGTGTCATCAGCATTCATCCTTGAAGCTATGGTGAATGTCATATCGGGCCCCAAAGT
    GCTAATGAAGCAAATTCCAATTTGGCTTCCTCTAGGTGTCGCTGATCAAAAGACCTACAGCTTTGACTCA
    ACTACGGCCGCCATCATGCTTGCTTCATACACTATCACCCATTTCGGCAAGGCAACCAATCCACTTGTCA
    GAGTCAATCGGCTGGGTCCTGGAATCCCGGATCATCCCCTCAGGCTCCTGCGAATTGGAAACCAGGCTTT
    CCTCCAGGAGTTCGTTCTTCCGCCAGTCCAACTACCCCAGTATTTCACCTTTGATTTGACAGCACTCAAA
    CTGATCACCCAACCACTGCCTGCTGCAACATGGACCGATGACACTCCAACAGGATCAAATGGAGCGTTGC
    GTCCAGGAATTTCATTTCATCCAAAACTTCGCCCCATTCTTTTACCCAACAAAAGTGGGAAGAAGGGGAA
    CAGTGCCGATCTAACATCTCCGGAGAAAATCCAAGCAATAATGACTTCACTCCAGGACTTTAAGATCGTT
    CCAATTGATCCAACCAAAAATATCATGGGAATCGAAGTGCCAGAAACTCTGGTCCACAAGCTGACCGGTA
    AGAAGGTGACTTCTAAAAATGGACAACCAATCATCCCTGTTCTTTTGCCAAAGTACATTGGGTTGGACCC
    GGTGGCTCCAGGAGACCTCACCATGGTAATCACACAGGATTGTGACACGTGTCATTCTCCTGCAAGTCTT
    CCAGCTGTGATTGAGAAGTAATTGCAATAATTGACTCAGATCCAGTTTTATAGAATCTTCTCAGGGATAG
    TGATAACATCTATTTAGTAATCCGTCCATTAGAGGAGACACTTTTAATTGATCAATATACTAAAGGTGCT
    TTACACCATTGTCTTTTTTCTCTCCTAAATGTAGAACTTAACAAAAGACTCATAATATACTTGTTTTTAA
    AGGATTGATTGATGAAAGATCATAACTAATAACATTACAAATAATCCTACTATAATCAATACGGTGATTC
    AAATGTTAATCTTTCTCATTGCACATACTTTTTGCCCTTATCCTCAAATTGCCTGCATGCTTACATCTGA
    GGATAGCCAGTGTGACTTGGATTGGAAATGTGGAGAAAAAATCGGGACCCATTTCTAGGTTGTTCACAAT
    CCAAGTACAGACATTGCCCTTCTAATTAAGAAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_066245.1 matrix protein [Zaire ebolavirus]
    MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVS
    SAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGP
    GIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFH
    PKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKN
    GQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Vaccination of BALB/c or C57BL/6 mice with eVLPs, composed of the EBOV glycoprotein and matrix viral protein (VP)40 with a lipid membrane, in conjunction with QS-21 adjuvant resulted in mixed IgG subclass responses, a Th1-like memory cytokine response, and protection from lethal EBOV challenge (Warfield et al., 2005).

    VP40 expressed from alphavirus replicons induced a protective immune response in BALB/c mice when challenged with Ebola virus Zaire (Wilson et al., 2001).
  • Related Vaccine(s): rVSV- SEBOV-GP and -VP40 , VRP expressing VP40
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.381
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
19. ZGP
  • Gene Name : ZGP
  • Sequence Strain (Species/Organism) : Zaire ebolavirus strain Zaire95
  • NCBI Nucleotide GI : 1695251
  • NCBI Protein GI : 1695253
  • Protein Accession : AAB37095.1
  • Other Database IDs : CDD:279888
    CDD:333284
    CDD:197367
  • Taxonomy ID : 186538
  • Gene Strand (Orientation) : ?
  • Protein Name : virion spike glycoprotein
  • Protein pI : 6.69
  • Protein Weight : 71315.12
  • Protein Length : 744
  • Protein Note : Filovirus glycoprotein; pfam01611
  • DNA Sequence : Show Sequence
    >gi|1695251|gb|U28077.1|EVU28077 Zaire Ebola virus strain Zaire95 virion spike glycoprotein (SP) gene, complete cds, and small/secreted glycoprotein precursor (SGP) gene, complete cds
    GCGATGAAGATTAAGCCGACAGTGAGCGTAATCTTCATCTCTCTTAGATTATTTGTCCTCCAGAGTAGGG
    ATCGTCAGGTCCTTTTCAATCGTATAACCAAAATAAACTTCACTAGAAGGATATTGTGGGGCAACAACAC
    AATGGGTGTTACAGGAATATTGCAGTTACCTCGTGATCGATTCAAGAGGACATCATTCTTTCTTTGGGTA
    ATTATCCTTTTCCAAAGAACATTTTCCATCCCACTTGGAGTCATCCACAATAGCACATTACAGGTTAGTG
    ATGTCGACAAACTGGTTTGCCGTGACAAACTGTCATCCACAAATCAATTGAGATCAGTTGGACTGAATCT
    CGAAGGGAATGGAGTGGCAACTGACGTGCCATCTGCAACTAAAAGATGGGGCTTCAGGTCCGGTGTCCCA
    CCAAAGGTGGTCAATTATGAAGCTGGTGAATGGGCTGAAAACTGCTACAATCTTGAAATCAAAAAACCTG
    ACGGGAGTGAGTGTCTACCAGCAGCGCCAGACGGGATTCGGGGCTTCCCCCGGTGCCGGTATGTGCACAA
    AGTATCAGGAACGGGACCGTGTGCCGGAGACTTTGCCTTCCACAAAGAGGGTGCTTTCTTCCTGTATGAC
    CGACTTGCTTCCACAGTTATCTACCGAGGAACGACTTTCGCTGAAGGTGTCGTTGCATTTCTGATACTGC
    CCCAAGCTAAGAAGGACTTCTTCAGCTCACACCCCTTGAGAGAGCCGGTCAATGCAACGGAGGACCCGTC
    TAGTGGCTACTATTCTACCACAATTAGATATCAAGCTACCGGTTTTGGAACCAATGAGACAGAGTATTTG
    TTCGAGGTTGACAATTTGACCTACGTCCAACTTGAATCAAGATTCACACCACAGTTTCTGCTCCAGCTGA
    ATGAGACAATATATACAAGTGGGAAAAGGAGCAATACCACGGGAAAACTAATTTGGAAGGTCAACCCCGA
    AATTGATACAACAATCGGGGAGTGGGCCTTCTGGGAAACTAAAAAAACCTCACTAGAAAAATTCGCAGTG
    AAGAGTTGTCTTTCACAGCTGTATCAAACAGAGCCAAAAACATCAGTGGTCAGAGTCCGGCGCGAACTTC
    TTCCGACCCAGGGACCAACACAACAACTGAAGACCACAAAATCATGGCTTCAGAAAATTCCTCTGCAATG
    GTTCAAGTGCACAGTCAAGGAAGGGAAGCTGCAGTGTCGCATCTGACAACCCTTGCCACAATCTCCACGA
    GTCCTCAACCCCCCACAACCAAACCAGGTCCGGACAACAGCACCCACAATACACCCGTGTATAAACTTGA
    CATCTCTGAGGCAACTCAAGTTGAACAACATCACCGCAGAACAGACAACGACAGCACAGCCTCCGACACT
    CCCCCCGCCACGACCGCAGCCGGACCCCTAAAAGCAGAGAACACCAACACGAGCAAGGGTACCGACCTCC
    TGGACCCCGCCACCACAACAAGTCCCCAAAACCACAGCGAGACCGCTGGCAACAACAACACTCATCACCA
    AGATACCGGAGAAGAGAGTGCCAGCAGCGGGAAGCTAGGCTTAATTACCAATACTATTGCTGGAGTCGCA
    GGACTGATCACAGGCGGGAGGAGAGCTCGAAGAGAAGCAATTGTCAATGCTCAACCCAAATGCAACCCTA
    ATTTACATTACTGGACTACTCAGGATGAAGGTGCTGCAATCGGACTGGCCTGGATACCATATTTCGGGCC
    AGCAGCCGAGGGAATTTACACAGAGGGGCTGATGCACAATCAAGATGGTTTAATCTGTGGGTTGAGACAG
    CTGGCCAACGAGACGACTCAAGCTCTTCAACTGTTCCTGAGAGCCACAACCGAGCTACGCACCTTTTCAA
    TCCTCAACCGTAAGGCAATTGATTTCTTGCTGCAGCGATGGGGCGGCACATGCCACATTTTGGGACCGGA
    CTGCTGTATCGAACCACATGATTGGACCAAGAACATAACAGACAAAATTGATCAGATTATTCATGATTTT
    GTTGATAAAACCCTTCCGGACCAGGGGGACAATGACAATTGGTGGACAGGATGGAGACAATGGATACCGG
    CAGGTATTGGAGTTACAGGCGTTATAATTGCAGTTATCGCTTTATTCTGTATATGCAAATTTGTCTTTTA
    GTTTTTCTTCAGATTGCTTCATGGCAAAGCTCAGCCTCAAATCAATGAAACCAGGATTTAATTATATGGA
    TTACTTGAATCTAAGATTACTTGACAAATGATAATATAATACACTGGAGCTTTAAACATAGCCAATGTGA
    TTCTAACTCTTTTAAACTCACAGTTAATCATAAATAAGGTTTGACATCAATCTAGTTATCTCTTTGAGAA
    TGATAAACTTGATGAAGATTAAGAAAAA
  • Protein Sequence : Show Sequence
    >AAB37095.1 virion spike glycoprotein [Zaire ebolavirus]
    MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNL
    EGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHK
    VSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPS
    SGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPE
    IDTTIGEWAFWETKKNLTRKIRSEELSFTAVSNRAKNISGQSPARTSSDPGTNTTTEDHKIMASENSSAM
    VQVHSQGREAAVSHLTTLATISTSPQPPTTKPGPDNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDT
    PPATTAAGPLKAENTNTSKGTDLLDPATTTSPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVA
    GLITGGRRARREAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQ
    LANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDF
    VDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.667
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
II. References
1. Bukreyev et al., 2006: Bukreyev A, Yang L, Zaki SR, Shieh WJ, Rollin PE, Murphy BR, Collins PL, Sanchez A. A single intranasal inoculation with a paramyxovirus-vectored vaccine protects guinea pigs against a lethal-dose Ebola virus challenge. Journal of virology. 2006; 80(5); 2267-2279. [PubMed: 16474134].
2. Garufi et al., 2012: Garufi G, Wang YT, Oh SY, Maier H, Missiakas DM, Schneewind O. Sortase-conjugation generates a capsule vaccine that protects guinea pigs against Bacillus anthracis. Vaccine. 2012; 30(23); 3435-3444. [PubMed: 22449424].
3. Hensley et al., 2010: Hensley LE, Mulangu S, Asiedu C, Johnson J, Honko AN, Stanley D, Fabozzi G, Nichol ST, Ksiazek TG, Rollin PE, Wahl-Jensen V, Bailey M, Jahrling PB, Roederer M, Koup RA, Sullivan NJ. Demonstration of cross-protective vaccine immunity against an emerging pathogenic Ebolavirus Species. PLoS pathogens. 2010; 6(5); e1000904. [PubMed: 20502688].
4. Warfield et al., 2005: Warfield KL, Olinger G, Deal EM, Swenson DL, Bailey M, Negley DL, Hart MK, Bavari S. Induction of humoral and CD8+ T cell responses are required for protection against lethal Ebola virus infection. Journal of immunology (Baltimore, Md. : 1950). 2005; 175(2); 1184-1191. [PubMed: 16002721].
5. Wilson et al., 2001: Wilson JA, Bray M, Bakken R, Hart MK. Vaccine potential of Ebola virus VP24, VP30, VP35, and VP40 proteins. Virology. 2001 Aug 1; 286(2); 384-90. [PubMed: 11485406].