VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Escherichia coli

Table of Contents
  1. Protective Antigens
    1. C0393
    2. C4424
    3. CFA/I
    4. CS1
    5. cssA
    6. eae
    7. efa1
    8. eltB
    9. espA
    10. espB
    11. etpA
    12. etsC
    13. faeG
    14. FdeC
    15. fedA
    16. fedF
    17. fimH
    18. FimH from E. coli str. K-12 substr. MG1655
    19. FimH from E. coli UTI89
    20. FimH/MrpH fusion protein
    21. fliC
    22. flu
    23. FyuA
    24. Hma
    25. ireA
    26. IroN
    27. Iss
    28. iutA
    29. MipA
    30. ompA
    31. ompC
    32. ompF
    33. ompT
    34. skp
    35. sta
    36. stx1B
    37. stx2eB
    38. StxB2
    39. Tir
    40. traT
1. C0393
  • Gene Name : C0393
  • Sequence Strain (Species/Organism) : Escherichia coli CFT073
  • VO ID : VO_0010989
  • NCBI Gene ID : 1034958
  • NCBI Protein GI : 26246291
  • Locus Tag : c0393
  • Genbank Accession : AE014075
  • Protein Accession : NP_752330
  • Taxonomy ID : 199310
  • Gene Starting Position : 371876
  • Gene Ending Position : 376006
  • Gene Strand (Orientation) : -
  • Protein Name : hemoglobin protease
  • Protein pI : 5.92
  • Protein Weight : 138492.32
  • Protein Length : 1376
  • Protein Note : Residues 1 to 1376 of 1376 are 79.04 pct identical to residues 1 to 1377 of 1377 from GenPept.129 : >emb|CAA11507.1| (AJ223631) haemoglobin protease [Escherichia coli]
  • DNA Sequence : Show Sequence
    >NC_004431.1:371876-376006 Escherichia coli CFT073, complete genome
    ATCAGAATGAATAACGAATATTAGCGTTTATCGCATCATCTGTGTTGTATTTACCGAATGCAGAGCGTTC
    AACTTCCAGCCCCAGACGCGTATTGTCGCCAAACCGGGCATTTAACCCCACACCGTAAAGCATACGACCG
    TCTTTTCTGCCATTAATCTGATGTTCTCCCGCTGCATCCTTCAGGTGAACGTCAGCACTGTCCGTCAGAT
    CGAACTCATAATGCAGGCCGGCACGGGCTGTCAGACTCCAGTCCTTACCACTGAAGGTTTTACCGGAAAC
    AACGCCGGTTCTGCCTACCAGAGGATTAACGCTGTTACGACGCATTGAGACATCCATTCCACTGTCGTTC
    CAGTTAAATGTTTGGCCCTGCAGTCTTCCCCAGACCAGTTCCGCCTGAGGTTCAACAAACGTCGTATCTG
    TCAGATGATAACGGTATCCGACTTCTGCACCTGCATACAGTGAATGGCTGCGGAAGTTCTGTTTACCAGC
    TCCGGCAAAGTTCAGGTCATATTTGTTTTCATTGTGAATATATTTGGCAATCAAATCAAAGTAAGCGCCG
    GACCGGAACAGACCACTGGCATAGAAACCACCACCCCATGATTTTGTTTTACCGCTGTACAGGCCTGCTG
    ACGCATCTGTGTCAGTGTAGGTGGCCATCACGCCGGTAAACAGGTCCATACTTCCCAGTTCGTGCTTACG
    GTCAGCCCCCATCTGCAGCAGGGTATAGTGGTCAGTGAAACCGCCATCAGCAGAGCCGGAACCGTTCAGC
    AGACGCACCCACGTACCGGCTTCGCCGTTAATATCCCTCAAATCGCCCATGCGTTTGTTCAGGTTGTTAA
    CTTCAGTGATGAAGTTGTTATAGCTGATGTGCATGAATGTGGCGGCAGCCTTACCCTGGCCGTCGTTACG
    TGCAACCTGGTAACCATCGAGGACCCACTCTTTTTTCCCGTCCTCTTTTCTGACACTAAGGGTGGGGGTG
    ACATCACTGAATCCCACAACCCGTGTTGATGCCCTGAACAGATTATCAGCTGTCGCTTCAGGTGCGCTGA
    CCAGTGGAATATCAAGCGTGTCCTTGTCAGAGGGTTTTTTCAGGAAGTTAACCCAGATGCTGTTGTCATG
    ACCTGTTGCCGACTTGTTTATCACCAGTTTGTCTGCCTTGTTAAGGTCTGTACGCATGACAAATGCTGAC
    TGAACCGCGTCCAGATTATCTGTTGTCAGTGTCGTGAACGATGATGTTCCCCCGTTAAAACCGACTATTG
    TCCGGTTAAGTTTCATATTTCCTGCCGTGGAGTTTCCGTTCATCGACCACTGGGTGTCTGTCATGCTGAC
    GGTGGCATCCGGTGCATTCAGGCTCCCGCTCCAGGTATTGCGGTACCCGTTAAACAGGCTGTACAACATC
    TGATTCTGAAGAGTCAGGTCAGGACTCAGTTCCCCTTCCCCTCCGAGGGTGACAGTCCCTTTATCCTGAA
    CATTGATATTACCTGACAACATACTGTACGGCCCCACGTTCAGGCGGGCATCGTCTCCCTTCAGGTTCCA
    TGAACCGGCATAATCGTATACAGGTAAAAGTGTGTGAGATACCTCATCAGGACGGCTGTTCAGACTCAGG
    GTGGCATCAGAAATATTCACCGGACCGTCAGAAACAAAACTCTGACTGGCCAGAACATTTGCTCCCTTGT
    TCAGATTCAGGGCGGTACTGGTCAGCGTTGAGTTCTCCAGAACGGCACTGTCTGAGGAGATATTCACGGT
    ACTGTTGTTCGCCTGTATTCCGCCATTGAATATCTCATTGATATTCAGCACTGACTGATTATCCAGGTTG
    ACGGTGCCGTTGAAGACGCTTTTATCTGCATCTTTAGTTGCAACAGATGTGCCTTCTTCAAGGGTAAATG
    CTGTTCCCTGGCCATCTTTTTTGTCGATAAATACCCGACTGTCGCCCAGCGTGACGCTGGAGTTATCTGC
    CTGGATGGTTGTGTTCAGTGTGGCATTGCGGCCCAGACCAAAGTCTGTATCTTTTAACACGAGCGAACCA
    AAGCTGAACGTCCTGTTCTCCCAGTCATCCTGTGTAAATGAGGTGGGCTGTGTCAGAACGGAATTGTCGC
    CCAGAGACGAGACTGTATTTGCAATACTCTGAGACGTTGAAGCATGGATAACCGGGTGGCCCTGAATGGT
    CAGACGACCGTTTTCCTGAGTAAATGTACCGGACATATTCGCTGAGCCGTCCATAACCAATGCGCCGGTT
    GTACCCGGGGTTGCTTTATTTGAGAAATTAATATTTCCCAGCAACTTGCCATGATACAGATACCCTTTAT
    TATTAATTCTGTTTGCAAGCAGTGCCTGTGCACTGTTCTGGTCATGTCCGACATATTCCCAGTGCTCGTT
    ACTGACCTGACCGGTAGGGAACCAGCCATAACTACTTGTTTTCAGGATAAAATAATCGACGGTATGAGTA
    TAGGGATTATTATAAATATATAATGAACCTACTGTTCCCCTGTTTGATGATGACCATTCATTAACTTTTA
    CGTCTGCCGGACGCGTCTGATAATCCAGAGTGATATTAGCCGTTTTATCACTGCTGTTACCGAGAGTTGC
    GCCATAATCGGCGGCATTCAGCTTATGAAATGTCAGGTCATTCCCGTTAACATCCAGAACCCCCCCCCGG
    TAGCCCCAGGATATATTGTCCGGATTAACCTGCTGGTTGTCTGCCAGCACGACTGTCGGGCGGCCGCTGG
    CAATATTCACGCTACTGAATGCCTGAACGTGTCCTGAACTGTCAGCCTGCTGATTGAGGACAACGGTCCC
    ATCCCCGACTTTCAGGCCGCCCTCATTAACACCGGTTCCCTGTACAACCAGGGTTCCTTCGCCGATTTTA
    TGCAGGTTGTCACCTTTCACACCATTAACCTGCCAGTTTACGGAGGCATCCTTGTCCACAATAATACCGG
    CCCCGGTCCAGGTACTTCCGTTTGAAGTGGTGACAGTGTAGTCATCAGTAAATGTCAGTGAACCGGCACC
    CTGCGTGACAGAGTTTTCCAGGTCAATCTGACCATTATGTCCCAGGAATGTCAGATTTTTACCTGCGTTC
    AGGTCAGAACCTTTTTGCCCGTGCATGGCATATTCATCGGAACCCTGTTTCAGAGAGCCAGTGCCGGTGC
    TGCTGTCAAATTTCCATTGCAGGGGGGCGCCGGATGAGGCATTAAAAAAGACGGGAGCGTCATTATCCTC
    TGAATAGATCTGTGAGAGAAAACTCTGAGGAATAAGAGAATATATCAAATTGGTCCCCCCTCCTACTCCC
    GAGTAAACACCGACCAGTTCCCACTGCCCTTTGGCCGTATTCCAGCCAAATAATGGAGAACCACTGTCGC
    CGGCCTCTCCAAAAGAGGGCAGGATGCTATGATCATGTATGTTGCCCCCCATATACAGCTGAATGCCGTC
    TGAGCCGTGATAAAAGAATGATGTCGGGAGTATTCCTCCTGTCAGATAACCATACCCACCTGTTACCCAA
    TGTCGCTTACCCTGACTATCCTGAATATACTGACTTCCCGAACCAGCCCTGTAGAATGCCGAGTATTTTG
    AAGGGTTCAATATATCAGCTGTTGATGAGCTGGTTACGGTAGCCGGAGCAACCTCAGTTACGAGCTTATC
    AAGTCTTGGTGTGTGGAGATCAGATGAACTGTGTTCATTACGATCCACAATATGGTAACTGTTCTGACCA
    TCACCGAAGCTGACGCTCTGATATCCTTTATTATGTTTTACACTGGCTATATATTGCGGGTTAATTAATG
    TTGCAACGCCGGGATTTGAGCTTACATTCACACTGCTAAAATCAACCATGGGCGCTTTATCAAGATGTCC
    TACTAATTCCCCTTTATTATTAAAAATAGGAATGTTTGTTGCGCCAGCCTGAAACTGCCCTTTGTTTTCT
    GCAAAGTCGCGGTATGTCTGGTAAGGATTGTTGCCACCAACCGTTGATGCACCAGCAACGGTTGGGAGTA
    ATGCAGATAGTGCCAGAGAGGTAAGTACTGAAAGTCTTTTTCCTCTGCGGGTACTCCCTTTACATACCCT
    TCGGGCTAGTTCAGAGACAACCTTTACTGTGTTAGTAATATAACAATATTTTAGAGCGTATATTTTATTC
    A
    
    
  • Protein Sequence : Show Sequence
    >NP_752330.1 hemoglobin protease [Escherichia coli CFT073]
    MNKIYALKYCYITNTVKVVSELARRVCKGSTRRGKRLSVLTSLALSALLPTVAGASTVGGNNPYQTYRDF
    AENKGQFQAGATNIPIFNNKGELVGHLDKAPMVDFSSVNVSSNPGVATLINPQYIASVKHNKGYQSVSFG
    DGQNSYHIVDRNEHSSSDLHTPRLDKLVTEVAPATVTSSSTADILNPSKYSAFYRAGSGSQYIQDSQGKR
    HWVTGGYGYLTGGILPTSFFYHGSDGIQLYMGGNIHDHSILPSFGEAGDSGSPLFGWNTAKGQWELVGVY
    SGVGGGTNLIYSLIPQSFLSQIYSEDNDAPVFFNASSGAPLQWKFDSSTGTGSLKQGSDEYAMHGQKGSD
    LNAGKNLTFLGHNGQIDLENSVTQGAGSLTFTDDYTVTTSNGSTWTGAGIIVDKDASVNWQVNGVKGDNL
    HKIGEGTLVVQGTGVNEGGLKVGDGTVVLNQQADSSGHVQAFSSVNIASGRPTVVLADNQQVNPDNISWG
    YRGGVLDVNGNDLTFHKLNAADYGATLGNSSDKTANITLDYQTRPADVKVNEWSSSNRGTVGSLYIYNNP
    YTHTVDYFILKTSSYGWFPTGQVSNEHWEYVGHDQNSAQALLANRINNKGYLYHGKLLGNINFSNKATPG
    TTGALVMDGSANMSGTFTQENGRLTIQGHPVIHASTSQSIANTVSSLGDNSVLTQPTSFTQDDWENRTFS
    FGSLVLKDTDFGLGRNATLNTTIQADNSSVTLGDSRVFIDKKDGQGTAFTLEEGTSVATKDADKSVFNGT
    VNLDNQSVLNINEIFNGGIQANNSTVNISSDSAVLENSTLTSTALNLNKGANVLASQSFVSDGPVNISDA
    TLSLNSRPDEVSHTLLPVYDYAGSWNLKGDDARLNVGPYSMLSGNINVQDKGTVTLGGEGELSPDLTLQN
    QMLYSLFNGYRNTWSGSLNAPDATVSMTDTQWSMNGNSTAGNMKLNRTIVGFNGGTSSFTTLTTDNLDAV
    QSAFVMRTDLNKADKLVINKSATGHDNSIWVNFLKKPSDKDTLDIPLVSAPEATADNLFRASTRVVGFSD
    VTPTLSVRKEDGKKEWVLDGYQVARNDGQGKAAATFMHISYNNFITEVNNLNKRMGDLRDINGEAGTWVR
    LLNGSGSADGGFTDHYTLLQMGADRKHELGSMDLFTGVMATYTDTDASAGLYSGKTKSWGGGFYASGLFR
    SGAYFDLIAKYIHNENKYDLNFAGAGKQNFRSHSLYAGAEVGYRYHLTDTTFVEPQAELVWGRLQGQTFN
    WNDSGMDVSMRRNSVNPLVGRTGVVSGKTFSGKDWSLTARAGLHYEFDLTDSADVHLKDAAGEHQINGRK
    DGRMLYGVGLNARFGDNTRLGLEVERSAFGKYNTDDAINANIRYSF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Active immunization of BALB/c mice with C0393 antigen in Freund's adjuvant protects mice from lethal challenge with ExPEC strain S26 (Durant et al., 2007).
  • COG: COG3468MU, under M: Cell wall/membrane/envelope biogenesis; U: Intracellular trafficking, secretion, and vesicular transport
  • Related Vaccine(s): E. coli vaccine based on recombinant protein CO393
  • Localization(Probability): Unknown
    (Prob.=0.587)
  • Adhesin Probability: 0.882
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
2. C4424
  • Gene Name : C4424
  • Sequence Strain (Species/Organism) : Escherichia coli CFT073
  • VO ID : VO_0010990
  • NCBI Gene ID : 1038067
  • NCBI Protein GI : 26250246
  • Locus Tag : c4424
  • Genbank Accession : AE014075
  • Protein Accession : NP_756286
  • Taxonomy ID : 199310
  • Gene Starting Position : 4205983
  • Gene Ending Position : 4211319
  • Gene Strand (Orientation) : +
  • Protein Name : adhesin
  • Protein pI : 4.25
  • Protein Weight : 166959.01
  • Protein Length : 1778
  • Protein Note : Escherichia coli O157:H7 ortholog: z5029
  • DNA Sequence : Show Sequence
    >NC_004431.1:4205983-4211319 Escherichia coli CFT073, complete genome
    AATGAACAAAATATTTAAAGTTATCTGGAATCCGGCAACAGGCAGTTACACCGTTGCCAGCGAAACGGCG
    AAGAGCCGTGGTAAAAAAAGCGGGCGCAGTAAGCTGTTAATTTCTGCACTGGTTGCGGGTGGGTTGTTGT
    CGTCGTTTGGGGCAAGTGCAGATAATTACACTGGGCAGCCAACTGATTATGGCGATGGCTCAGCAGGTGA
    CGGCTGGGTTGCTATCGGTAAAGGGGCAAAAGCAAATACCTTTATGAACACTAGTGGCGCGAGTACAGCT
    TTAGGATATGACGCGATAGCCGAAGGTGAGTACAGTTCTGCCATCGGGTCAAAAACCCTTGCAACTGGTG
    GAGCATCCATGGCGTTCGGGGTTAGTGCAAAAGCAATGGGTGACAGAAGTGTCGCGCTAGGTGCATCGTC
    AGTAGCAAATGGCGATCGTTCGATGGCTTTTGGTCGTTACGCAAAGACGAATGGTTTTACATCTCTTGCT
    ATTGGGGACTCCTCCCTTGCCGATGGTGAAAAAACTATTGCGTTAGGAAATACGGCTAAAGCTTACGAAA
    TTATGAGCATCGCCCTCGGTGATAATGCCAATGCGTCAAAAGAGTATGCAATGGCGCTGGGAGCAAGTAG
    CAAAGCTGGCGGTGCTGATAGCCTCGCATTCGGCAGAAAATCTACAGCTAATAGCACTGGCTCACTGGCA
    ATAGGTGCTGACAGTAGCAGTTCGAACGATAACGCCATCGCGATAGGGAACAAAACGCAAGCCCTGGGAG
    TGAATTCGATGGCCCTGGGTAATGCAAGTCAGGCATCTGGCGAATCCAGTATTGCATTAGGTAACACCAG
    TGAAGCCAGCGAACAAAATGCGATTGCGCTGGGGCAAGGTAGCATTGCAAGCAAAGTGAACTCAATCGCG
    TTGGGAAGTAACAGTTTGTCCTCGGGAGAGAATGCCATCGCATTGGGAGAGGGTAGTGCCGCTGGTGGCA
    GCAACAGCCTTGCTTTCGGTAGCCAGTCCAGGGCAAACGGCAATGATTCTGTCGCCATCGGTGTAGGGGC
    TGCAGCAGCGACCGACAATTCTGTCGCTATCGGCGCAGGATCGACCACAGATGCAAGCAATACGGTTTCA
    GTTGGCAACAGCGCAACAAAACGCAAAATTGTTAATATGGCTGCTGGTGCCATAAGCAACACCAGTACCG
    ATGCCATCAACGGCTCACAGCTTTATACGATCAGTGATTCAGTCGCCAAGCGACTCGGAGGAGGCGCTAC
    TGTAGGCAGCGATGGCACCGTAACCGCAGTAAGCTACGCGTTGAGAAGCGGAACCTATAATAACGTGGGT
    GATGCTCTGTCAGGAATCGACAATAATACCCTACAATGGAATAAAACCGCGGGGGCGTTCAGCGCCAATC
    ACGGTGCAAATGCCACCAACAAAATCACTAATGTTGCTAAAGGTACGGTTTCTGCAACCAGCACCGATGT
    AGTAAACGGCTCTCAATTGTACGACCTGCAGCAGGATGCTCTGTTGTGGAACGGCACAGCATTCAGTGCC
    GCACACGGCACCGAAGCCACCAGCAAAATCACTAACGTCACCGCTGGCAACCTGACTGCCGGCAGCACTG
    ACGCCGTTAACGGCTCTCAGCTCAAAACCACCAACGACAACGTGACGACCAACACCACCAACATCGCCAC
    TAACACCACCAATATCACCAACCTGACTGACGCTGTTAACGGTCTCGGTGACGACTCCCTGCTGTGGAAC
    AAAGCAGCTGGCGCATTCAGCGCCGCGCACGGCACCGAAGCCACCAGCAAAATCACCAACGTCACCGCTG
    GCAACCTGACTGCCGGTAGCACTGACGCCGTTAACGGCTCCCAGCTCAAAACCACCAACGACAACGTGAC
    GACCAACACCACCAACATCGCCACTAACACCACCAATATCACCAACCTGACTGACGCTGTTAACGGTCTC
    GGTGACGACTCCCTGCTGTGGAACAAAACAGCTGGCGCATTCAGCGCCGCGCACGGCACTGACGCCACCA
    GCAAGATCACCAACGTCACCGCTGGCAACCTGACTGCCGGCAGCACTGACGCCGTTAACGGCTCCCAGCT
    CAAAACCACCAACGACAACGTGACGACCAACACCACCAACATCGCCACTAACACCACCAATATCACCAAC
    CTGACTGACGCTGTTAACGGTCTCGGTGACGACTCCCTGCTGTGGAACAAAACAGCTGGCGCATTCAGCG
    CCGCGCACGGCACTGACGCCACCAGCAAGATCACCAATGTCAAAGCCGGTGACCTGACAGCTGGCAGCAC
    TGACGCCGTTAACGGCTCTCAGCTCAAAACCACCAACGATAACGTGTCGACCAACACCACCAACATCACC
    AACCTGACTGACGCTGTTAACGGTCTCGGTGACGACTCCCTGCTGTGGAACAAAACAGCTGGCGCATTCA
    GCGCCGCTCACGGCACTGACGCCACCAGCAAGATCACCAATGTCAAAGCCGGTGACCTGACAGCTGGCAG
    CACTGACGCCGTTAACGGCTCCCAGCTCAAAACCACCAACGATAACGTGTCGACCAACACCACCAACATC
    ACTAACCTGACGGATTCCGTTGGCGACCTTAAGGACGATTCTCTGCTGTGGAACAAAGCGGCTGGCGCAT
    TCAGCGCCGCGCACGGTACCGAAGCTACCAGCAAGATCACCAACTTACTGGCTGGCAAGATATCTTCTAA
    CAGCACTGATGCCATTAATGGCTCACAACTTTATGGCGTAGCGGATTCATTTACGTCATATCTTGGTGGT
    GGTGCTGATATCAGCGATACGGGTGTATTAAGTGGGCCAACCTACACTATTGGTGGTACTGACTACACTA
    ACGTCGGTGATGCTCTGGCAGCCATTAACACATCATTTAGCACATCACTCGGCGACGCCCTACTTTGGGA
    TGCAACCGCAGGCAAATTCAGCGCCAAACACGGCATTAATAATGCTCCCAGTGTAATCACTGATGTTGCA
    AACGGTGCAGTCTCGTCCACCAGCAGCGACGCCATTAACGGTTCACAACTTTATGGTGTTAGTGACTACA
    TTGCCGATGCTCTGGGCGGGAATGCTGTGGTGAACACTGACGGCAGTATCACTACACCAACTTATGCCAT
    CGCTGGCGGCAGTTACAACAACGTCGGTGACGCGCTGGAAGCGATCGATACCACGCTGGATGATGCTCTG
    CTGTGGGATACAACAGCCAATGGCGGTAACGGTGCATTTAGCGCCGCTCACGGGAAAGATAAAACTGCCA
    GTGTAATCACTAACGTCGCTAACGGTGCAGTCTCTGCCACCAGCAACGATGCCATTAATGGCTCACAGCT
    CTATAGCACTAATAAGTACATCGCTGATGCGCTGGGTGGTGATGCAGAAGTCAACGCTGACGGTACTATC
    ACTGCACCGACTTACACCATTGCAAATACCGATTACAACAACGTCGGTGAAGCCCTGGATGCGCTCGATA
    ATAACGCGCTGCTGTGGGATGAAGACGCAGGTGCCTACAACGCCAGCCATGATGGCAATGCCAGCAAAAT
    CACCAACGTTGCGGCTGGTGATCTCTCCACAACCAGTACCGATGCTGTTAACGGTTCCCAGTTAAACGCA
    ACCAATATTCTGGTTACGCAAAATAGCCAAATGATTAACCAGCTTGCTGGTAACACTAGCGAAACCTACA
    TCGAGGAAAACGGTGCGGGTATTAACTATGTACGTACCAACGACAGCGGCTTAGCGTTCAACGATGCCAG
    CGCTTCAGGTATTGGCGCTACAGCTGTAGGTTATAACGCAGTTGCCTCTCATGCCAGCAGTGTAGCCATC
    GGTCAGGACAGCATCAGCGAAGTTGATACGGGTATCGCTCTGGGTAGCAGTTCCGTTTCCAGCCGTGTAA
    TAGTTAAAGGGACTCGTAACACCAGCGTATCGGAAGAAGGTGTTGTGATTGGTTATGACACCACGGATGG
    CGAACTGCTTGGCGCGTTGTCGATTGGTGATGACGGTAAATATCGTCAAATCATCAACGTCGCGGATGGT
    TCTGAAGCCCATGATGCGGTCACTGTTCGCCAGTTGCAAAACGCCATTGGTGCAGTCGCAACCACACCAA
    CCAAATACTATCACGCCAACTCAACGGCTGAAGACTCACTGGCAGTCGGTGAAGACTCGCTGGCAATGGG
    CGCGAAAACCATCGTTAATGGTAATGCGGGTATTGGTATCGGCCTGAACACGCTGGTTCTGGCTGATGCG
    ATCAACGGTATTGCTATCGGTTCTAACGCACGCGCAAATCATGCCGACAGCATTGCAATGGGTAATGGTT
    CTCAGACTACCCGTGGTGCGCAGACCAACTACACTGCCTACAACATGGATGCACCGCAGAACTCTGTGGG
    TGAGTTCTCTGTCGGCAGTGAAGACGGTCAACGTCAGATCACCAACGTCGCAGCAGGTTCGGCGGATACC
    GATGCGGTTAACGTGGGTCAGTTGAAAGTAACGGACGCGCAGGTTTCCCAGAATACCCAGAGCATTACTA
    ACCTGAACACTCAGGTCACTAATCTGGATACTCGCGTGACCAATATCGAAAACGGCATTGGCGATATCGT
    AACCACCGGTAGCACTAAGTACTTCAAGACCAACACCGATGGCGCAGATGCCAACGCGCAGGGTAAAGAC
    AGTGTTGCGATTGGTTCTGGTTCCATTGCTGCCGCTGACAACAGCGTCGCACTGGGCACGGGTTCCGTAG
    CAGACGAAGAAAACACCATCTCTGTGGGTTCTTCTACCAACCAGCGTCGTATCACCAACGTTGCTGCCGG
    TGTTAATGCCACCGATGCGGTTAACGTTTCGCAACTGAAGTCTTCTGAAGCAGGCGGCGTTCGCTACGAC
    ACCAAAGCTGATGGCTCTATCGACTACAGCAACATCACTCTCGGTGGCGGCAATAGCGGTACGACTCGCA
    TCAGCAACGTTTCTGCTGGCGTGAACAACAACGACGCAGTGAACTATGCGCAGTTGAAGCAAAGTGTGCA
    GGAAACGAAGCAATACACCGATCAGCGCATGGTTGAGATGGATAACAAACTGTCCAAAACTGAAAGCAAG
    CTGAGTGGTGGTATCGCTTCTGCAATGGCAATGACCGGTCTGCCGCAGGCTTACACGCCGGGTGCCAGCA
    TGGCCTCTATTGGTGGCGGTACTTACAACGGTGAATCGGCTGTTGCTTTAGGTGTGTCGATGGTGAGCGC
    CAATGGTCGTTGGGTCTACAAATTACAAGGTAGTACCAATAGCCAGGGTGAATACTCCGCCGCACTCGGT
    GCCGGTATTCAGTGGTA
    
    
  • Protein Sequence : Show Sequence
    >NP_756286.1 adhesin [Escherichia coli CFT073]
    MNKIFKVIWNPATGSYTVASETAKSRGKKSGRSKLLISALVAGGLLSSFGASADNYTGQPTDYGDGSAGD
    GWVAIGKGAKANTFMNTSGASTALGYDAIAEGEYSSAIGSKTLATGGASMAFGVSAKAMGDRSVALGASS
    VANGDRSMAFGRYAKTNGFTSLAIGDSSLADGEKTIALGNTAKAYEIMSIALGDNANASKEYAMALGASS
    KAGGADSLAFGRKSTANSTGSLAIGADSSSSNDNAIAIGNKTQALGVNSMALGNASQASGESSIALGNTS
    EASEQNAIALGQGSIASKVNSIALGSNSLSSGENAIALGEGSAAGGSNSLAFGSQSRANGNDSVAIGVGA
    AAATDNSVAIGAGSTTDASNTVSVGNSATKRKIVNMAAGAISNTSTDAINGSQLYTISDSVAKRLGGGAT
    VGSDGTVTAVSYALRSGTYNNVGDALSGIDNNTLQWNKTAGAFSANHGANATNKITNVAKGTVSATSTDV
    VNGSQLYDLQQDALLWNGTAFSAAHGTEATSKITNVTAGNLTAGSTDAVNGSQLKTTNDNVTTNTTNIAT
    NTTNITNLTDAVNGLGDDSLLWNKAAGAFSAAHGTEATSKITNVTAGNLTAGSTDAVNGSQLKTTNDNVT
    TNTTNIATNTTNITNLTDAVNGLGDDSLLWNKTAGAFSAAHGTDATSKITNVTAGNLTAGSTDAVNGSQL
    KTTNDNVTTNTTNIATNTTNITNLTDAVNGLGDDSLLWNKTAGAFSAAHGTDATSKITNVKAGDLTAGST
    DAVNGSQLKTTNDNVSTNTTNITNLTDAVNGLGDDSLLWNKTAGAFSAAHGTDATSKITNVKAGDLTAGS
    TDAVNGSQLKTTNDNVSTNTTNITNLTDSVGDLKDDSLLWNKAAGAFSAAHGTEATSKITNLLAGKISSN
    STDAINGSQLYGVADSFTSYLGGGADISDTGVLSGPTYTIGGTDYTNVGDALAAINTSFSTSLGDALLWD
    ATAGKFSAKHGINNAPSVITDVANGAVSSTSSDAINGSQLYGVSDYIADALGGNAVVNTDGSITTPTYAI
    AGGSYNNVGDALEAIDTTLDDALLWDTTANGGNGAFSAAHGKDKTASVITNVANGAVSATSNDAINGSQL
    YSTNKYIADALGGDAEVNADGTITAPTYTIANTDYNNVGEALDALDNNALLWDEDAGAYNASHDGNASKI
    TNVAAGDLSTTSTDAVNGSQLNATNILVTQNSQMINQLAGNTSETYIEENGAGINYVRTNDSGLAFNDAS
    ASGIGATAVGYNAVASHASSVAIGQDSISEVDTGIALGSSSVSSRVIVKGTRNTSVSEEGVVIGYDTTDG
    ELLGALSIGDDGKYRQIINVADGSEAHDAVTVRQLQNAIGAVATTPTKYYHANSTAEDSLAVGEDSLAMG
    AKTIVNGNAGIGIGLNTLVLADAINGIAIGSNARANHADSIAMGNGSQTTRGAQTNYTAYNMDAPQNSVG
    EFSVGSEDGQRQITNVAAGSADTDAVNVGQLKVTDAQVSQNTQSITNLNTQVTNLDTRVTNIENGIGDIV
    TTGSTKYFKTNTDGADANAQGKDSVAIGSGSIAAADNSVALGTGSVADEENTISVGSSTNQRRITNVAAG
    VNATDAVNVSQLKSSEAGGVRYDTKADGSIDYSNITLGGGNSGTTRISNVSAGVNNNDAVNYAQLKQSVQ
    ETKQYTDQRMVEMDNKLSKTESKLSGGIASAMAMTGLPQAYTPGASMASIGGGTYNGESAVALGVSMVSA
    NGRWVYKLQGSTNSQGEYSAALGAGIQW
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Active immunization of BALB/c mice with C4424 antigen in Freund's adjuvant protects mice from lethal challenge with ExPEC strain S26 (Durant et al., 2007).
  • COG: COG5295UW, under U: Intracellular trafficking, secretion, and vesicular transport; W: Extracellular structures
  • Related Vaccine(s): E. coli C4424 protein vaccine
  • Localization(Probability): Outer Membrane
    (Prob.=0.995)
  • Adhesin Probability: 0.939
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
3. CFA/I
  • Gene Name : CFA/I
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : AAB22177
  • Other Database IDs : CDD:282325
  • Taxonomy ID : 562
  • Protein Name : colonization factor antigen I
  • Protein pI : 5.58
  • Protein Weight : 14379.9
  • Protein Length : 253
  • Protein Note : CFA/I
  • Protein Sequence : Show Sequence
    >AAB22177.1 colonization factor antigen I, CFA/I [Escherichia coli, H10407 (O78:H-), Peptide, 147 aa]
    VEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTD
    VLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVS
    LVMTLGS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zeinalzadeh et al., 2017)
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.836
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
4. CS1
  • Gene Name : CS1
  • Sequence Strain (Species/Organism) : Escherichia coli 536
  • VO ID : VO_0010941
  • NCBI Gene ID : 4188469
  • NCBI Protein GI : 110643341
  • Locus Tag : ECP_3188
  • Genbank Accession : CP000247
  • Protein Accession : YP_671071
  • Taxonomy ID : 362663
  • Gene Starting Position : 3361397
  • Gene Ending Position : 3361897
  • Gene Strand (Orientation) : -
  • Protein Name : CS1 type fimbrial major subunit
  • Protein pI : 8.86
  • Protein Weight : 15880.12
  • Protein Length : 166
  • Protein Note : CS1 type firmbrial major subunit; CS1 pili; coli surface antigen 1
  • DNA Sequence : Show Sequence
    >NC_008253.1:3361397-3361897 Escherichia coli 536, complete genome
    ATTAGAGAGCCTGGGACAGATAAATGCTAACTACGCCACGGTAGATACCCGTTTCCAGAACACCTTTGGT
    AGCCTGGGAAAACATCAGTGGTTTAGCCAGCGAACCGTTAGTTAACGCATCGGAAGCAAAGATTTTCGTT
    GCGGTAAACGTGGTTGCCGCATCAGCAGCAATCACTTCACCACCCCAGGTTACGGTCAGCGGAACAATTT
    TGCTGGCGTCCACGCTCTGAACCAGTTGCGCAGGCGAAACTAACTGCATTTTCACGTCTTTGGTCGTGTC
    ATTTGACCAGATTTTAGTCATTAACTGGTAAGATTGCAGACCCTGACCTGGCAGATATTGCATTTCTACT
    GCCTTCGGCAGTGCAGTATTATCGGTCTGCGTCATATCCAGAGCAGCATCAACGTTAGCAGTAACAGTGA
    TATCTTTTTGTACTGCTAATGCAGAACCTGCAACGGAAAACATTGCCGCTACCAGAAGAGATTTTGCGAA
    TACCTTTTTCA
    
    
  • Protein Sequence : Show Sequence
    >YP_671071.1 CS1 type fimbrial major subunit [Escherichia coli 536]
    MKKVFAKSLLVAAMFSVAGSALAVQKDITVTANVDAALDMTQTDNTALPKAVEMQYLPGQGLQSYQLMTK
    IWSNDTTKDVKMQLVSPAQLVQSVDASKIVPLTVTWGGEVIAADAATTFTATKIFASDALTNGSLAKPLM
    FSQATKGVLETGIYRGVVSIYLSQAL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : ETEC also expresses a range of colonisation factor antigens (CFAs), which allow adherence to the mucosal surface and therefore colonisation of the intestine. Some CFAs are sub-divided into coli surface (CS) antigens (Daley et al., 2007).
  • Related Vaccine(s): EHEC O157 subunit vaccine using his-tagged N-terminal intimin , Live attenuated ETEC vaccine ACAM2017 , Shiga Toxin 2 B Subunit Vaccine
  • Localization(Probability): Extracellular
    (Prob.=0.972)
  • Adhesin Probability: 0.802
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
5. cssA
  • Gene Name : cssA
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Gene ID : 16833872
  • NCBI Protein GI : 543130020
  • Locus Tag : D616_p104124
  • Genbank Accession : AB702969
  • Protein Accession : YP_008531445
  • Other Database IDs : CDD:293436
  • Taxonomy ID : 562
  • Plasmid No : pCss165Kan
  • Gene Starting Position : 94109
  • Gene Ending Position : 94573
  • Gene Strand (Orientation) : -
  • Protein Name : CS6 structural subunit A
  • Protein pI : 5.74
  • Protein Weight : 15564.38
  • Protein Length : 154
  • Protein Note : CS6 fimbrial subunits A and B, Coli surface antigen 6; pfam16831
  • DNA Sequence : Show Sequence
    >NC_022333.1:94109-94573 Escherichia coli plasmid pCss165Kan DNA, complete genome, strain: 4266 delta cssB::Km
    TTTAGTTTACATAGTAACCAACCATAACCTGATCGTTATATATCCCAGGAGGTATTTCTTTATCTCCGCT
    AGTATAATTCAGCGCTCTAAAAGTTATTTGTTGATTAGGCGTAACCTCTGCACCATGATCTTTTAACATT
    TTTCTCCCTTTATCATCAACAATCTGGTAGATTATTGATTGGGAATCATCAGCGGTATTTACGAGTCGTC
    CTAACCCATAATCTTCATCATAAACAGGGTAGACCGTTACCTGGGATACATTTTCAGGAACAGTTAAGCT
    CACACTAAATAATAAACCTCCTTCCTTTCCAACATTTTTACCAAAAGAAGGCTGGATTTGTGGTTCAGGC
    GCAAAAAAACTTTTTGAAATAGTCGTTGATACTGGGAAGTTTTTAGTCGCTATTTCTGTTCTGGCATGGC
    TGCCGAATGAAGCAAGAATTAGAATTAAACCAATTGTTTTCTTCA
  • Protein Sequence : Show Sequence
    >YP_008531445.1 CS6 structural subunit A (plasmid) [Escherichia coli]
    MKKTIGLILILASFGSHARTEIATKNFPVSTTISKSFFAPEPQIQPSFGKNVGKEGGLLFSVSLTVPENV
    SQVTVYPVYDEDYGLGRLVNTADDSQSIIYQIVDDKGRKMLKDHGAEVTPNQQITFRALNYTSGDKEIPP
    GIYNDQVMVGYYVN
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zeinalzadeh et al., 2017)
  • Localization(Probability): Unknown
    (Prob.=0.2)
  • Adhesin Probability: 0.524
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
6. eae
  • Gene Name : eae
  • Sequence Strain (Species/Organism) : Escherichia coli O157:H7 str. EDL933
  • VO ID : VO_0010944
  • NCBI Gene ID : 960862
  • NCBI Protein GI : WP_129935252
  • Locus Tag : Z5110
  • Genbank Accession : AE005174
  • Protein Accession : NP_290259
  • 3D structure: PDB ID : 1E5U
  • Taxonomy ID : 562
  • Gene Starting Position : 4665440
  • Gene Ending Position : 4668244
  • Gene Strand (Orientation) : -
  • Protein Name : intimin
  • Protein pI : 9.19
  • Protein Weight : 95549.71
  • Protein Length : 997
  • Protein Note : Intimin adherence protein
  • DNA Sequence : Show Sequence
    >NC_002655.2:4665440-4668244 Escherichia coli O157:H7 str. EDL933 genome
    ATTATTCTACACAAACCGCATAGACATTTGGAGTATTAACATTAACCCCAGGAAGAGGGTTTTGTGTTAT
    TAGGTTATAAGTGCTTGATACTCCAGAACGCTGCTCACTAGATGTCTGTTTAATCCAAGCAGTTATTGAG
    TTCATAGAACTATAATGGCTATATTTATTTGCAGCCCCCCATGAGTCATAAATATCTGACAATACCGTCT
    GTGTGGATGGTAATAAATTTTTGCAAATGGACATAGCATCAGCATAATAGGCTTGCTTATCCACTTTTAT
    CATATACGACGGTGCTTTTATAGTGTAACTTACTGTTTGCTTATCACCAGATGTGGCTTTAATTACGACA
    CTGCCTTTACCATTCAAAGTGACTTTCCCTGATGCATCGACAGTCGCGATACTGGTATTTTCTGAATACC
    ATGAATATGTACCATCACCACCGCTTGCTTTCAGTTTAAACTGACCATATTGCAGCCAAATATTAGGCAA
    CTCGCCTCTGACATTGTTACCAATAATATCAACCTTGTTGTCAATTTTCAGTTCATCAAAAAAAGTGACC
    TCAGTCGCTTTAACCTCAGCCCCATCACTGACTGTCGCACTAACAGTCGCTTTACCGGCGGAACTGGAAG
    TTAGTGTTATCGTCGCACGACCATCATTTCCCGTGGTTGCTTGCGTTTGAGACTTACCGTTGAACATCCC
    AAAGTTTGTTGAGAATGTAACGGATTGATTATTAACTGGCTGACCGTTTTTCATAACTTTTACAGTATAT
    TTAATAGCATCCTTACCATTTGCTACTGCAGTTGTCTTATCAGCCTTAATCTCAGTAATGCTGGCCTTGG
    TTTGATCAAAAAATATAACCGCACTGGCATTAAGTGCTGAAGTCATCTCCGCGGTTTTAGCAGACACGAC
    GACCTGTCCTGGCGTACTCGACTTCAACGTTACGGTTGCCTTACCGTTAGCATCCGTTTTGGCACTATTT
    GCCCCAAGAGTTGCAGTTCCTGAAACAATATTAAATGAAACAGGGACATTAGCCTGAGCTACCCCATTCT
    TTTTCACCGTCGCGGTATAAGTAATGGTATCGGCGTTATCCGCTTTAGCCGAAGTCTTATCCGCCGTAAA
    GTCCGTTACCCCAACCTGGTCGACAACTTGACCATTCGACAGAACGGTAATAGTAAGCTGTACATTGTTA
    GAGCTATTGCCATTACGGTCATAGGCGCGAGCCGTCACTTTATAAATATTGCTGCCACCTTGCACATAAG
    CAGGCAAAATAGCCTGGTAGTCTTGTGCGCTTTGGCTTCCGCTATGCTGAATCTGACCGCCCTGACTGCG
    TAATGCACTATCATCCCAGACGATACGATCCAGACCGTATTTGCTCTTAACGATCAACTGAATCTTCTGC
    GTACTGTGTTCAGTACCATTAATATCATGCGGAATATTCAGAGAAAGAATATCCTGCTTCTTGTACTCCA
    GAATAATATTGTTATTACGCTGAACCAGATCGTAACGGCTGCCTGATAATGTTCTTAACTCGTTAACATA
    CTGTGGTTCAATTTGCTGAGACCACGATTTATCAAACTGATAACGGAACTGCATTGAGTAAAGGAGATCA
    TTTTCATTACCCGTACCATGACGGTAATCGATCCCCATCGTCACCAGAGGAATCGGAGTATAGTTTACAC
    CAACGGTCGCCGCACCAGGATTCGACTGCAGCTTATCAGAATTAAACAAAGCAACATTATCACCATAATA
    CTGCTCATATATCAGCTTGGCGCCTAATGCCGGATATGACGGTAGATAGCCATTAAAACGGATATCGAAG
    CCATTTGCTGGGCGCTCATCATAGTCTTTCTTATTGTATGACTCATGCCAGCCGCTCATGCGGAAATAGC
    CGTTAACGCTACTTTTGAAATAGTCTCGCCAGTATTCGCCACCAATACCTAAACGGGTATTATCACCAGA
    AAAATCCTGATCAATGAAGACGTTATAGCCCAACATGTTTGCAGGAAGGAAAAAACGCTGACCCGCACCT
    AAATTTGCCGTAAAGCGGGAGTCAATGTAACGCGCTCCGACCTGACCAAATGCCAGCATTTTTTCGGAAT
    CATAGAACGGTAATAAGAAGTCCAGTGAACTACCGTCAAAGTTATTACCACTCTGCAGATTAACCTCTGC
    CGTTCCATAATGTTGTAACCAGGCCTGCAACTGTGACGAAGCCTGGTTACCAGCGATACCAAGAGCGGTA
    TCTTTCGCGTAATCGCCGTTCAGAGATCGCGACTGAAGCTGGCTACCGAGACTCGCCGCCTGTTGTGCCG
    CATAATTTAATGCCTTGTCATCGGTCATGTTGCTTTTGGTCACGTCCGGGGACATTTTAGTCAGTTTATT
    CGTGTGACCAGCAACACCACCTGCAGCAACAAGAGGTGCCGAACCTAAAAGTGGTAGTGCACTGTATTCA
    AAGGGAAGTTTTTTGAGTGGCAAAATGATCTGCTGACCAGGCGCGGCCTTCATCATTTCGCTTTCAGAAC
    TGTATAAATGCTTATTCAACGACCAAATCGTCGATAAATTAATATCTTGCGATTTAGAAAGATCGGCAAC
    AGTTTCACCAGTTTTCAACGTATAAAAAAGGCGATTCTGATAGCTATCATGAGTTAACAGTTTTGAATCC
    GAACCCAATTTAAAATAATTTTCACCATTTGCAAATGAATTCTGATTAACATAAAAAAACAATCCTAAAC
    CAGCACTAAGCATAATCAATGTTTTTTTTAGCTTATGCTTGTGCCGGGTCCGGGTATAACAACCATGAGT
    AATCA
  • Protein Sequence : Show Sequence
    >WP_129935252.1 intimin [Escherichia coli]
    MITHGFYARTRHKHKLKKTFIMLSAGLGLFFYVNQNSFANGENYFKLSSDSKLLTQNAAQDRLFYTLKTG
    ETVANISKSQGISLSVIWSLNKHLYSSESEMMKAGPGQQIILPLKKLSVEYSALPVLGSAPVVAAGGVAG
    HTNKMTKMSPDATKSNTTDDKALNYAAQQAASLGSQLQSRSLNGDYAKDTALGMASSQASSQLQAWLQHY
    GTAEVNLQSGNNFDGSSLDFLLPFYDSENMLAFGQVGARYIDSRFTANLGAGQRFFLPENMLGYNVFIDQ
    DFSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLMY
    EQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKPWSQQIE
    PQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNIPHDINGTEHSTQKIQLIVKSKYGLDRIVWDDS
    ALRSQGGQIQHGGSQSAQDYQAILPAYVQGGSNIYKVTARAYDRNGNSSNNVQLTITVLPNGQVVDQVGV
    TDFTADKTSAKADGIEAITYTATVKKNGVAQANVPVTFSIVSGTATLGANSARTDGNGKATVTLKSATLG
    QVVVSAKTAEMTSPLNASAVIFVDQTKASITEIKADKTTAKADGSDAITYTVRVMKEGAPVVDQKVTFSK
    DFGTLNKTEATTDQNGYATVKLSSNTPGKAIVSAKVSGVGTEVKATTVEFFAPLSIDGDKVTVIGTGITG
    ALPKNWLQYGQVKLQATGGNGKYTWKSSNTKIASVDNSGVITLNEKGSATITVVSGDNQSATYTINAPGS
    IVIAVDKNTRVTYFDAENKCKTNSANLAQSKELLANIYSTWGAANKYPYYSGSNSLTAWIKQSSSEQSSG
    VSSTYDLVTKNQLINVGVNNKNAFSVCVK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Systemic immunization of calves with a combination of EspA, intimin-531, and H7 flagellin resulted in a significant reduction in shedding of EHEC O157 to levels predicted to significantly impact on EHEC O157 cattle-to-cattle transmission (McNeilly et al., 2015)
  • Related Vaccine(s): E. coli O157:H7 intimin vaccine , E. coli vaccine using intimin polypeptide
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.891
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
7. efa1
  • Gene Name : efa1
  • Sequence Strain (Species/Organism) : Escherichia coli O157:H7
  • NCBI Gene ID : 916316
  • NCBI Protein GI : WP_001239095
  • Locus Tag : ECs3860
  • Genbank Accession : NC_002695
  • Protein Accession : NP_311887
  • Other Database IDs : CDD:315573
    CDD:327708
  • Taxonomy ID : 562
  • Gene Starting Position : 3867200
  • Gene Ending Position : 3868501
  • Gene Strand (Orientation) : +
  • Protein Name : cytotoxin
  • Protein pI : 9.61
  • Protein Weight : 49129.25
  • Protein Length : 486
  • Protein Note : TcdB toxin N-terminal helical domain; pfam12918
  • DNA Sequence : Show Sequence
    >gi|916316|gb|H40264.1|H40264 yp59e12.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:191758 3', mRNA sequence
    NATNTATCAATGAAGATTTTTATTCAAGCTTAAAGTAAAAAGTAATTTTAGTTAAGAAAAATGAAGTACC
    AGATAAACTGTAACATATATTTTAACTTAGAAGTATCAAAACAGGAATTTTTTGATTCTCTAAGTGGTGG
    TCTCTGCAAAATGGAGCTTGAAGAAATCTTTTACATACCAATTTGATAAGAGTCTGCTGACCACGATCTG
    TCATTTTCTTTACTATGGGCTTCTGGGAGAATGAATGCTATTTTAAGGCCAAATGTGTTTTTCTTTCTTC
    TCCCCTTTCCCTGACTTTTCCCTTTCTCCCATCCCCGACCACCTACCCCACAATGGGNAGGAATTTTTGA
    CATC
  • Protein Sequence : Show Sequence
    >WP_001239095.1 cytotoxin [Escherichia coli]
    MRLPEKVLFPPVTSGLSGQEKQKKPKSITGFQENYQRNIRPIKTASEARLRFFDKMVSKENSLEDVVSLG
    EMIQKEIYGHEQRTFSPVHHTGNWKSSLLHNALLGLANVYNGLRETEYPNTFNRDGIKSTNSFRDNLLTK
    TRTPRDNFEEGIKHPEHATIPYDNDNESNKLLKAGKIAGNNNELLMEIKKESQSDHQIPLSDKFLKRKKR
    SPVAEDKVQNSLTPENFVQKISLSDELKTKYANEILEIKRIMGEYNLLPDKNSRNGLKLLQKQADLLKII
    MEDTSVTENTFKNIEMAIADIKREYYSHTVDIEKNIHAIWVAGSPPESISDYIKTFLKTYKEFTYYLWVD
    EKAFGAAKFTSVLKQIAFDLACRTIQQNTPQKNIDFINLYNEIRKKYNNNPSGQQEYLNKLRELYATYQK
    ISTPLKHMFNSFF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Efa-1 is a factor for adherence that influences colonisation of the bovine intestines. Non-O157 EHEC, including serotype O26:H-, contain a full-length copy of efa-1 while EHEC O157:H7 contains a truncated form which is predicted to encode the amino-terminal 433 amino acids of the protein (efa-1) (van et al., 2007).
8. eltB
  • Gene Name : eltB
  • Sequence Strain (Species/Organism) : Escherichia coli
  • VO ID : VO_0010943
  • NCBI Protein GI : 157021162
  • 3D structure: PDB ID : 1PZI
  • Other Database IDs : CDD:279687
  • Taxonomy ID : 562
  • Gene Strand (Orientation) : ?
  • Protein Name : LTB
  • Protein pI : 8.8
  • Protein Weight : 13952.05
  • Protein Length : 162
  • Protein Note : Heat-labile enterotoxin beta chain; pfam01376
  • Protein Sequence : Show Sequence
    >ABV01313.1 LTB [Escherichia coli]
    MNKVKCYVLFTALLSSLYAHGAPQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQ
    VEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : LT is a hetero-oligomeric AB5 type enterotoxin composed of a 27 kDa A subunit with toxic ADP ribosyl transferase activity and a stable noncovalent-linked pentamer of 11.6 kDa B subunits. ETEC infection and colonization of the small intestine, and the production of LT, causes acute diarrhea that can be fatal without intervention (Moravec et al., 2007).

    Immunized mice developed antibodies that were capable of detecting each recombinant subunit in addition to native CS6 protein and also protected the mice against ETEC challenge. (Zeinalzadeh et al., 2017)
  • Related Vaccine(s): soybean-expressed E. coli LTB vaccine
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.572
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
9. espA
  • Gene Name : espA
  • Sequence Strain (Species/Organism) : Escherichia coli O157:H7
  • NCBI Protein GI : EIP05353
  • Taxonomy ID : 1286877
  • Gene Strand (Orientation) : ?
  • Protein Name : espA
  • Protein pI : 5.13
  • Protein Weight : 15791.36
  • Protein Length : 206
  • Protein Sequence : Show Sequence
    >EIP05353.1 espA [Escherichia coli O157:H7 str. TW14313]
    MFSYMYQAQSNLSIAKFADMNEASKASTTAQKMANLVDAKIADVQSSTDKNAKAKLPQDVIDYINDPRND
    ISVTGIRDLSGDLSAGDLQTVKAAISAKANNLTTVVNNSQLEIQQMSNTLNLLTSARSDVQSLQYRTISA
    ISLGK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Intranasal immunization protected against EHEC O157:H7 colonization and infection in mice at a rate of 90% (Lin et al., 2017).

    Immunization of calves with recombinant EHEC O157 EspA, intimin and Tir resulted in the generation of antibodies capable of cross-reacting with antigens from non-O157 EHEC serotypes, suggesting that immunization with these antigens may provide a degree of cross-protection against other EHEC serotypes (McNeilly et al., 2015).
  • Localization(Probability): Unknown
    (Prob.=0.2)
  • Adhesin Probability: 0.753
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
10. espB
  • Gene Name : espB
  • Sequence Strain (Species/Organism) : Escherichia coli O157:H7
  • NCBI Protein GI : EIP05354
  • Taxonomy ID : 1286877
  • Gene Strand (Orientation) : ?
  • Protein Name : espB
  • Protein pI : 5.48
  • Protein Weight : 27035.18
  • Protein Length : 326
  • Protein Sequence : Show Sequence
    >EIP05354.1 espB [Escherichia coli O157:H7 str. TW14313]
    MLEIQKLLGKMVTLLQDYQQKQLAQSYQIQQAVFESQNKAIEEKKAAATAALVGGIISSALGILGSFAAM
    NNAAKGAGEIAEKASSASSKAAGAASEVANKALVKATESVADVAEEASSAMQKAMATTTKAASRASGVAD
    DVAKASDFAEDLADAAEKTSRINKLLNSVDKLTNTTAFVAVTSLAEGTKTLPTTISESVKSTHEVNEQRA
    KSLENFQQGNLELYKQDVRRTQDDITTRLRDITSAVRDLLEVQNRMGQSGRLAG
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Immunized mice exhibited significant protection against E. coli O157:H7 colonization, as indicated by the reduced amount and/or duration of the bacterial fecal shedding, which demonstrate the protective potential of EspB as an oral vaccine against EHEC infection (Ahmed et al., 2014)
  • Localization(Probability): Extracellular
    (Prob.=0.971)
  • Adhesin Probability: 0.559
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
11. etpA
  • Gene Name : etpA
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : AAX13509
  • Other Database IDs : CDD:289765
    CDD:297026
    CDD:225751
  • Taxonomy ID : 316401
  • Gene Strand (Orientation) : ?
  • Protein Name : EtpA
  • Protein pI : 10.25
  • Protein Weight : 170560.242
  • Protein Length : 1852
  • Protein Note : enterotoxigenic Escherichia coli (ETEC);
    pSC1 is the putative plasmid on which these genes reside
  • Protein Sequence : Show Sequence
    >AAX13509.2 EtpA (plasmid) [Escherichia coli ETEC H10407]
    MNRIYKLKFDKRRNELVVVSEITTGVGNAKATGSVEGEKSPRRGVRAMALSLLSGMMIMAHPAMSANLPT
    GGQIVAGSGSIQTPSGNQMNIHQNSQNMVANWNSFDIGKGNTVQFDQPSSSAVALNRVVGGGESQIMGNL
    KANGQVFLVNPNGVLFGEGASVSTSGFVASTRDIKNDDFMNRRYTFSGGQKAGAAIVNQGELTTNAGGYI
    VLAADRVSNSGTIRTPGGKTVLAASERITLQLDNGGLMSVQVTGDVVNALVENRGLVSARDGQVYLTALG
    RGMLMNTVLNVSGVVEASGMHRQDGNIVLDGGDSGVVHLSGTLQADNASGQGGKVVVQGKNILLDKGSNI
    TATGGQGGGEVYVGGGWQGKDSNIRNADKVVMQGGARIDVSATQQGNGGTAVLWSDSYTNFHGQISAKGG
    ETGGNGGRVETSSHGNLQAFGTVSASAKKGKAGNWLLDSADITIVNGSNVSKTETTQSPPHTQFAPTAAG
    SAVSNTSINNRLNNGTSVTILTHRTRTGTAQGGNITVNAAINKSNGSDVNLTLQAGGNITVNNSITSTEG
    KLNVNLSGARTSNGSITISNNANITTNGGDITVGTTNTSNRVNISINNTTLNASNGNIQLTGTGTDSGIL
    FAGNNRLTASNIALTGNSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGEST
    SGNAINLTDTTGTTTLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTN
    SASSGVYLKDARITSTNGSITANGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLT
    ASNIALTGNSTSGNAINLTGTATLNATNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINL
    KGNNTLTASNITLTGESTSGNAINLTDTTGTTTLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEI
    SNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSITANGTATANGKATHLDGNVTLNASNGRIKLTG
    NGHGSASGILFAGNNRLTASNIALTGNSTSGNAINLTGTATLNATNDITLTGSSTSGNAINLTGTATLNA
    TNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTTTLNATNNITMQGTRVQIKHS
    NITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSITANGTATANGKATH
    LDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTSGNAINLTGTATLNATNDITLTG
    SSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTTTL
    NATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITST
    NGSITTNGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTSGNAI
    NLTGTATLNATNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGE
    STSGNAINLTDTTGTTTLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAK
    TNSASSGVYLKDARITSTNGSITANGTAPANDNATYLDGNVTLNASNGSIKLTGNGNGSTSGILFAGNNT
    LTASNITLTGNSEVYWQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Oral vaccination with EtpA adjuvanted with dmLT afforded significant protection against small intestinal colonization, and the degree of protection correlated with fecal IgG, IgA, or total fecal antibody responses to EtpA (Luo et al., 2016).
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.935
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
12. etsC
  • Gene Name : etsC
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : YP_444081
  • Other Database IDs : CDD:332259
  • Taxonomy ID : 562
  • Protein Name : EtsC
  • Protein pI : 6.04
  • Protein Weight : 50215.8
  • Protein Length : 511
  • Protein Note : avian pathogenic strain
  • Protein Sequence : Show Sequence
    >YP_444081.1 EtsC (plasmid) [Escherichia coli]
    MKILSSLTLCLITALCSGCTNVLKSDYRAPEVNYPINWTKGDVDGNTSPFDWEEFNDPNLDNWLHLVMTS
    NNDIAIAALRIHRAQLDAERTGITNTPALKAALSMDGKKQLNNSSGWAKSGSASLGTSYELDLWGKIARQ
    RDVAEWAVHASEEDFRSARLMLLSEASNNYWRIGFVNQQITTLQQSIDYAKETLRLAEVRYRAGNISSLD
    VIDAQQNLLTQENQLTGLQREHSQLLNQQAVLLGTVPGCQIVEPTTLPKGSLPKVNANIPASILMRRPDI
    SAKEWQLREALATVDIKRSEYYPTFNLTGALGTSSASLLALLHNPVGSVGANLTLPFLEWRQRDIEVKIA
    RNDYEQRVLEFKQLLYKAMSSIEDALSFRNQLLLQETRLREELELARKSEWLNEVRYRHGAVRISFWLDA
    QEKRRQAELRLDENRFNQLQNLAKIYLEFGGASTFP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : recombinant antigens (rAg) vaccine combining common ExPEC surface proteins EtsC, OmpA, OmpT, and TraT showed significantly (P < 0.05) elicited IgY against specific antigens, induced immune related mRNA expression in the spleen and bursa, reduced in vitro growth of multiple APEC serotypes, and decreased bacterial loads in the heart and spleen, and gross lesion scores of the air sac, heart and liver in chickens. (Van et al., 2017)
  • Localization(Probability): Outer Membrane
    (Prob.=0.992)
  • Adhesin Probability: 0.149
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
13. faeG
  • Gene Name : faeG
  • Sequence Strain (Species/Organism) : Escherichia coli SE11
  • VO ID : VO_0010993
  • NCBI Gene ID : 7003192
  • NCBI Protein GI : WP_000751752
  • Locus Tag : ECSE_P3-0034
  • Genbank Accession : AP009243
  • Protein Accession : YP_002295988
  • Other Database IDs : CDD:308182
  • Taxonomy ID : 562
  • Plasmid No : pSE11-3
  • Gene Starting Position : 32214
  • Gene Ending Position : 33053
  • Gene Strand (Orientation) : ?
  • Protein Name : F4 fimbrial adhesin subunit FaeG
  • Protein pI : 4.87
  • Protein Weight : 27947.04
  • Protein Length : 356
  • Protein Note : Fimbrial, major and minor subunit; pfam02432
  • DNA Sequence : Show Sequence
    >NC_011416.1:32214-33053 Escherichia coli SE11 plasmid pSE11-3 DNA, complete sequence
    TATGAAAAAGACTCTGATTGCACTGGCGCTGGCTGCCTCTGCTGTATCTGGTATGGCGCATGCCTGGACG
    TCTGGTGACTTCAATGGCACGGTCGATATCGGTGGTAGCATTGATGCAACTAATTATCGCCAGAAATGGG
    AATGGGAAGTTGGTACGGGGCTTAATGGATTTTATAATGCTCTGAGTGAGTTGACAAATAATGATACAAA
    ACTGACTATTACTGTTACTGGTAATAAGCCAATTTTGTTAGGCCGAACCAAAGAAGCATTTGTAACGCCG
    ACAGCAGGTGGCTGGGGTGGCATCCCTCAGATTGCATTTACCGACTATAAAGGAGCACCGGTAGAGCTCA
    AAAACCCTGATGGTGAAACTAATAAAGGTTTAGCATATTTTGTTCTGCCGATGAAAAATGCAGATGGTAC
    TGAAGCGGGTTCCGTGAGAGTGAATGCATCTTATGCTGGGGCTGTGGTTGAAAAGACTTCTGATAGTTCG
    GCTAAATTGTTCTCTGCTTATGCCGGTGAGGTAATTCGCATCTTCAATGGCGGTCTTCCGGTGAATGTTA
    CCCAGTCTGAACTGCAGTCAGGTGTTGCTGCTGCTGATAGAACAGCATTGTTTGGTAGTCTGGGGAAAGC
    TGATTTGGTAGCGCAGTTTCAAGCTGTTATTCCTGGGGCTACTGTGACTGATGGGACGAGCTCAGAACAT
    TGTACAATGAGACTATTGGCCTCAGCTGCCTATGCACTGGGTATTGCAGATGGTCAGACTATTGAGGCAA
    CTTTTAATCAGGCTGTAACTACCAGCACTCAGTGGAGCGCTCCGCTGAACGTAGCAATTACTTATTACTA
  • Protein Sequence : Show Sequence
    >WP_000751752.1 F4 fimbrial adhesin subunit FaeG [Escherichia coli]
    MKKTLIALAIAASAASGMAHAWMTGDFNGSVDIGGTITADDYRQKWEWEVGTGLNGFGNVLNDLTNGGTK
    LTITVTGNKPILLGRTKEAFATPVIGGVDGIPQIAFTDYEGASVELRKPDGGTNKGLAYFVLPMKNAGGT
    KVGSVKVNASYAGVLGRGGVTSADGELLSLFADGLSSIFYGGLPRGSELSAGSAAAARTKLFGSLSRDDI
    LGQIQRVNANITSLVDVAGSYRENMEYTDGTVVSAAYALGIANGQTIEATFNQAVTTSTQWSAPLNVAIT
    YY
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Oral immunization of FaeG-expressing L. lactis exhibits a protective response against ETEC infection in mice (Hu et al., 2009).
  • Localization(Probability): Extracellular
    (Prob.=0.972)
  • Adhesin Probability: 0.928
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
14. FdeC
  • Gene Name : FdeC
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : WP_000092542
  • Other Database IDs : CDD:314749
    CDD:329065
    CDD:214751
  • Taxonomy ID : 562
  • Gene Strand (Orientation) : ?
  • Protein Name : intimin-like adhesin FdeC
  • Protein pI : 5.02
  • Protein Weight : 138099.78
  • Protein Length : 1499
  • Protein Note : Inverse autotransporter, beta-domain; pfam11924
  • Protein Sequence : Show Sequence
    >WP_000092542.1 intimin-like adhesin FdeC [Escherichia coli]
    MSRYKTDNKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAARAQHAVQPRLSMENTTVTADNNVEK
    NVASLAANAGTFLSSQPDSDATRNFITGMATAKANQEIQEWLGKYGTARVKLNVDKNFSLKDSSLEMLYP
    IYDTPTNMLFTQGAIHRTDDRTQSNIGFGWRHFSENDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKL
    SANGYIRASGWKKSPDVEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHA
    ITAEVNYTPVPLLTLSAGHKQGKSGENDTRFGLEVNYRIGEPLEKQLDTDSIRERRMLAGSRYDLVERNN
    NIVLEYRKSEVIRIALPERIEGKGGQTVSLGLVVSKATHGLKNVQWEAPSLLAAGGKITGQGNQWQVTLP
    AYQAGKDNYYAISAIAYDNKGNASKRVQTEVVISGAGMSADRTALTLDGQSRIQMLANGNEQKPLVLSLR
    DAEGQPVTGMKDQIKTELTFKPAGNIVTRTLKATKSQAKPTLGEFTETEAGVYQSVFTTGTQSGEATITV
    SVDDMSKTVTAELRATMMDVSNSTLSANEPSGDVVADGQQAYTLTLTAVDSEGNPVTGEASRLRLVPQDT
    NGVTVGAISEIKPGVYSATVSSTRAGNVVVRAFSEQYQLGTLQQTLKFVAGPLDAAHSSITLNPDKPVVG
    GTVTAIWTAKDANDNPVTGLNPDAPSLSGAAAAGSTASGWTDNGDGTWTAQISLGTTAGELDVMPKLNGQ
    DAAANAAKVTVVADALSSNQSKVSVAEDHVKAGESTTVTLVAKDAHGNAISGLSLSASLTGTASEGATVS
    SWTEKGDGSYVATLTTGGKTGELRVMPLFNGQPAATEAAQLTVIAGEMSSANSTLVADNKTPTVKTTTEL
    TFTMKDAYGNPVTGLKPDAPVFSGAASTGSERPSAGNWTEKGNGVYVSTLTLGSAAGQLSVMPRVNGQNA
    VAQPLVLNVAGDASKAEIRDMTVKVNNQLANGQSANQITLTVVDSYGNPLQGQEVTLTLPQGVTSKTGNT
    VTTNAAGKVDIELMSTVAGELEIEASVKNSQKTVKVKFKADFSTGQASLEVDAAAQKVANGKDAFTLTAT
    VKDQYGNLLPGAVVVFNLPRGVKPLADGNIMVNADKEGKAELKVVSVTAGTYEITASAGNDQPSNAQSVT
    FVADKTTATISSIEVIGNRAVADGKTKQTYKVTVTDANNNLLKDSEVTLTASPENLVLTPNGTATTNEQG
    QAIFTATTTVAATYTLTAKVEQADGQESTKTAESKFVADDKNAVLAASPERVDSLVADGKTTATLTVTLM
    SGVNPVGGTMWVDIEAPEGVTEADYQFLPSKNDHFASGKITRTFSTNKPGTYTFTFNSLTYGGYEMKPVT
    VTINAVPADTEGAEEK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Intranasal mucosal immunization with recombinant FdeC significantly reduced kidney colonization in mice challenged transurethrally with uropathogenic E. coli (Nesta et al., 2012).
  • Localization(Probability): Outer Membrane
    (Prob.=0.949)
  • Adhesin Probability: 0.217
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
15. fedA
  • Gene Name : fedA
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : WP_119805777
  • Other Database IDs : CDD:321493
  • Taxonomy ID : 562
  • Gene Strand (Orientation) : ?
  • Protein Name : F18 fimbrial major subunit FedA
  • Protein pI : 9.16
  • Protein Weight : 17140.83
  • Protein Length : 242
  • Protein Note : Fimbrial protein; cl01416
  • Protein Sequence : Show Sequence
    >WP_119805777.1 F18 fimbrial major subunit FedA [Escherichia coli]
    MKRLVFISFVALSMTAGSAMAQQGDVKFFGSVSATTCNLTPQISGTVGDTIQLGTVTPNGIGSEIPFALK
    ASSTTGGCASLSNKTADITWSGQLTEKGFANQGGVARDSYVALKTVNGKTQPAQEVKASNSTVNFDASKA
    TTEGFKFTAQLKGGQTPGDFQGAAAYAVTYK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The immunized mice showed significant protection efficacy against a lethal dose 50 of a virulent strain, resulting in approximately 85% and 92% survival rates in mice with a single- and double-dose immunization, respectively, compared to only 40% of the non-immunized controls (Won and John, 2017).
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.929
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
16. fedF
  • Gene Name : fedF
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : CAA81288
  • Other Database IDs : UniProtKB/TrEMBL: Q47212
  • Taxonomy ID : 562
  • Gene Strand (Orientation) : ?
  • Protein Name : FedF
  • Protein pI : 9.25
  • Protein Weight : 31357.97
  • Protein Length : 342
  • Protein Note : gene is part of the F107 fimbrial gene cluster
  • Protein Sequence : Show Sequence
    >CAA81288.1 FedF [Escherichia coli]
    MRLKYILIIPLLLISLSVFASTLQVDKSVSYDWINSSASSAQVTGTLLGTGKTNTTQMPALYTWQHQIYN
    VNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTG
    FEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVPAIAKSYRLDTSITLPDTVNLKQNQATPVY
    YTFSAPSVSNTITGIPNQNDMPSSNVKLTIGPIQSKTTALYVQPDATGSWYDLSKSITMTVVKSSMLNFK
    GINAKPGNVTLSVPIVFEIQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The immunized mice showed significant protection efficacy against a lethal dose 50 of a virulent strain, resulting in approximately 85% and 92% survival rates in mice with a single- and double-dose immunization, respectively, compared to only 40% of the non-immunized controls (Won and John, 2017).
  • Localization(Probability): Extracellular
    (Prob.=0.965)
  • Adhesin Probability: 0.842
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
17. fimH
  • Gene Name : fimH
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : AGA03820
  • Other Database IDs : CDD:198456
    CDD:312615
    CDD:321493
  • Taxonomy ID : 562
  • Gene Strand (Orientation) : ?
  • Protein Name : FimH
  • Protein pI : 7.9
  • Protein Weight : 28487.08
  • Protein Length : 342
  • Protein Note : uropathogenic strain
  • Protein Sequence : Show Sequence
    >AGA03820.1 FimH [Escherichia coli]
    MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYP
    ETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVA
    IKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAK
    SQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYART
    GGQVTAGNVKSIIGVTFVYQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Of the vaccine preparations, Fusion, Fusion + CT, and FimH admixed with FliC and CT showed the best protection against UPEC (Asadi et al., 2016).
  • Localization(Probability): Unknown
    (Prob.=0.465)
  • Adhesin Probability: 0.943
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
18. FimH from E. coli str. K-12 substr. MG1655
  • Gene Name : FimH from E. coli str. K-12 substr. MG1655
  • Sequence Strain (Species/Organism) : Escherichia coli str. K-12 substr. MG1655
  • VO ID : VO_0010987
  • NCBI Gene ID : 948847
  • NCBI Protein GI : 16132141
  • Locus Tag : b4320
  • Genbank Accession : CP009685
  • Protein Accession : NP_418740
  • Taxonomy ID : 511145
  • Gene Starting Position : 4548807
  • Gene Ending Position : 4549709
  • Gene Strand (Orientation) : +
  • Protein Name : type 1 fimbriae D-mannose specific adhesin
  • Protein pI : 7.88
  • Protein Weight : 27803.36
  • Protein Length : 300
  • Protein Note : minor fimbrial subunit, D-mannose specific adhesin
  • DNA Sequence : Show Sequence
    >NC_000913.3:4548807-4549709 Escherichia coli str. K-12 substr. MG1655, complete genome
    AATGAAACGAGTTATTACCCTGTTTGCTGTACTGCTGATGGGCTGGTCGGTAAATGCCTGGTCATTCGCC
    TGTAAAACCGCCAATGGTACCGCTATCCCTATTGGCGGTGGCAGCGCCAATGTTTATGTAAACCTTGCGC
    CCGTCGTGAATGTGGGGCAAAACCTGGTCGTGGATCTTTCGACGCAAATCTTTTGCCATAACGATTATCC
    GGAAACCATTACAGACTATGTCACACTGCAACGAGGCTCGGCTTATGGCGGCGTGTTATCTAATTTTTCC
    GGGACCGTAAAATATAGTGGCAGTAGCTATCCATTTCCTACCACCAGCGAAACGCCGCGCGTTGTTTATA
    ATTCGAGAACGGATAAGCCGTGGCCGGTGGCGCTTTATTTGACGCCTGTGAGCAGTGCGGGCGGGGTGGC
    GATTAAAGCTGGCTCATTAATTGCCGTGCTTATTTTGCGACAGACCAACAACTATAACAGCGATGATTTC
    CAGTTTGTGTGGAATATTTACGCCAATAATGATGTGGTGGTGCCTACTGGCGGCTGCGATGTTTCTGCTC
    GTGATGTCACCGTTACTCTGCCGGACTACCCTGGTTCAGTGCCAATTCCTCTTACCGTTTATTGTGCGAA
    AAGCCAAAACCTGGGGTATTACCTCTCCGGCACAACCGCAGATGCGGGCAACTCGATTTTCACCAATACC
    GCGTCGTTTTCACCTGCACAGGGCGTCGGCGTACAGTTGACGCGCAACGGTACGATTATTCCAGCGAATA
    ACACGGTATCGTTAGGAGCAGTAGGGACTTCGGCGGTGAGTCTGGGATTAACGGCAAATTATGCACGTAC
    CGGAGGGCAGGTGACTGCAGGGAATGTGCAATCGATTATTGGCGTGACTTTTGTTTATCAATA
    
    
  • Protein Sequence : Show Sequence
    >NP_418740.1 type 1 fimbriae D-mannose specific adhesin [Escherichia coli str. K-12 substr. MG1655]
    MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYP
    ETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVA
    IKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAK
    SQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYART
    GGQVTAGNVQSIIGVTFVYQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Antibodies directed at the putative binding region of FimH (anti- s-FimH1-25) significantly reduced E. coli bladder infections in the experimental mouse model of urinary tract infections (Thankavel et al., 1997).
  • Related Vaccine(s): E. coli FimH with CFA and then IFA , KLH-s-FimH1-25 with CFA and then IFA
  • Localization(Probability): Unknown
    (Prob.=0.465)
  • Adhesin Probability: 0.958
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
19. FimH from E. coli UTI89
  • Gene Name : FimH from E. coli UTI89
  • Sequence Strain (Species/Organism) : Escherichia coli UTI89
  • VO ID : VO_0010945
  • NCBI Gene ID : 3992235
  • NCBI Protein GI : 91213965
  • Locus Tag : UTI89_C5017
  • Genbank Accession : CP000243
  • Protein Accession : YP_543951
  • 3D structure: PDB ID : 1TR7
  • Taxonomy ID : 364106
  • Gene Starting Position : 4913554
  • Gene Ending Position : 4914456
  • Gene Strand (Orientation) : +
  • Protein Name : type 1 fimbiral adhesin FimH
  • Protein pI : 7.88
  • Protein Weight : 27858.43
  • Protein Length : 300
  • DNA Sequence : Show Sequence
    >NC_007946.1:4913554-4914456 Escherichia coli UTI89, complete genome
    AATGAAACGAGTTATTACCCTGTTTGCTGTACTGCTGATGGGCTGGTCGGTAAATGCCTGGTCATTCGCC
    TGTAAAACCGCCAATGGTACCGCAATCCCTATTGGCGGTGGCAGCGCCAATGTTTATGTAAACCTTGCGC
    CTGCCGTGAATGTGGGGCAAAACCTGGTCGTAGATCTTTCGACGCAAATCTTTTGCCATAACGATTACCC
    AGAAACCATTACAGACTATGTCACACTGCAACGAGGTGCGGCTTATGGCGGCGTGTTATCTAGTTTTTCC
    GGGACCGTAAAATATAATGGCAGTAGCTATCCTTTCCCTACTACCAGCGAAACGCCGCGGGTTGTTTATA
    ATTCGAGAACGGATAAGCCGTGGCCGGTGGCGCTTTATTTGACGCCGGTGAGCAGTGCGGGGGGAGTGGC
    GATTAAAGCTGGCTCATTAATTGCCGTGCTTATTTTGCGACAGACCAACAACTATAACAGCGATGATTTC
    CAGTTTGTGTGGAATATTTACGCCAATAATGATGTGGTGGTGCCCACTGGCGGCTGCGATGTTTCTGCTC
    GTGATGTCACCGTTACTCTGCCGGACTACCCTGGTTCAGTGCCGATTCCTCTTACCGTTTATTGTGCGAA
    AAGCCAAAACCTGGGGTATTACCTCTCCGGCACAACCGCAGATGCGGGCAACTCGATTTTCACCAATACC
    GCGTCGTTTTCACCCGCGCAGGGCGTCGGCGTACAGTTGACGCGCAACGGTACGATTATTCCAGCGAATA
    ACACGGTATCGTTAGGAGCAGTAGGGACTTCGGCGGTAAGTCTGGGATTAACGGCAAATTACGCACGTAC
    CGGAGGGCAGGTGACTGCAGGGAATGTGCAATCGATTATTGGCGTGACTTTTGTTTATCAATA
    
    
  • Protein Sequence : Show Sequence
    >YP_543951.1 type 1 fimbiral adhesin FimH [Escherichia coli UTI89]
    MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYP
    ETITDYVTLQRGAAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVA
    IKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAK
    SQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYART
    GGQVTAGNVQSIIGVTFVYQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : FimH is a protective antigen (Langermann et al., 1997)

    Of the vaccine preparations, Fusion, Fusion + CT, and FimH admixed with FliC and CT showed the best protection against UPEC (Asadi et al., 2016).
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=0.982)
  • Adhesin Probability: 0.958
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
20. FimH/MrpH fusion protein
  • Gene Name : FimH/MrpH fusion protein
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : AHW46359
  • Other Database IDs : CDD:198456
    CDD:286270
    CDD:294848
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : FimH/MrpH fusion protein
  • Protein pI : 8.73
  • Protein Weight : 55910.91
  • Protein Length : 644
  • Protein Note : Escherichia coli/Proteus mirabilis fusion
  • Protein Sequence : Show Sequence
    >AHW46359.1 FimH/MrpH fusion protein [synthetic construct]
    MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYP
    ETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVA
    IKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAK
    SQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYART
    GGQVTAGNVKSIIGVTFVYQMFIFKRFPAIFILIAGLFSAPAMASIFSYITESTGTPSNATYTYVIERWD
    PETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGP
    SLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPPVGACKISEGAVNLNYGDIDEASLSGAKRSETI
    NVTCNLAMKVLVIASGSDSGRVPLRADKSLYADLYLNNYPGEKGVTVNVPAGGSAPVSVSSTLRTNGRVA
    PGRFSGSGSIILTMP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Immunization of mice with MrpH.FimH fusion with MPL or a mixture of FimH, MrpH and MPL conferred the highest protection of the bladder and kidneys when challenged with UPEC and P. mirabilis in a UTI mouse model (Habibi et al., 2015)
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=0.946)
  • Adhesin Probability: 0.816
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
21. fliC
  • Gene Name : fliC
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : 429545217
  • Other Database IDs : CDD:236140
    CDD:279061
    CDD:289230
    CDD:279090
  • Taxonomy ID : 562
  • Gene Strand (Orientation) : ?
  • Protein Name : FliC
  • Protein pI : 4.38
  • Protein Weight : 54849.99
  • Protein Length : 609
  • Protein Note : uropathogenic strain
  • Protein Sequence : Show Sequence
    >AGA03821.1 FliC [Escherichia coli]
    MAQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNAND
    GISVAQTTEGALSEINNNLQRVRELTVQATTGTNSQSDLDSIQDEIKSRLDEIDRVSGQTQFNGVNVLAK
    DGSMKIQVGANDGQTITIDLKKIDSSTLNLTGFNVNGSGSVANTAATKADLTAAQLSAPGAADANGTVTY
    TVSAGYKESTAADVIASIKDGSAPTSAITATINNGFGDSSALTSNDYTYDPAKGDFTYDVASSANNTAAQ
    VQSFLTPKAGDTANLKVTVGTTSVDVVLASDGKITAKDGSALYIDSTGNLTQNSAGLTSAKLATLTGLQG
    SGVASTITTEDGTNIDIAANGNIGLTGVRISADSLQSATKSTGFTVGTGATGLTVGTDGKVTIGGTTAQS
    YTSKDGSLTTDNTTKLYLQKDGSVTNGSGKAVYVEADGDFTTDAATKAATTTDPLKALDEAISQIDKFRS
    SLGAIQNRLDSAVTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLL
    QGP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Of the vaccine preparations, Fusion, Fusion + CT, and FimH admixed with FliC and CT showed the best protection against UPEC (Asadi et al., 2016).
  • Localization(Probability): Extracellular
    (Prob.=0.996)
  • Adhesin Probability: 0.881
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
22. flu
  • Gene Name : flu
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : 49176177
  • Other Database IDs : CDD:315649
    CDD:225999
    CDD:328937
    UniProtKB/UniProt: P39180
    ASAP:ABE-0006642
    ECOCYC:G7080
    EcoGene:EG12686
  • Taxonomy ID : 511145
  • Gene Strand (Orientation) : ?
  • Protein Name : CP4-44 prophage; self recognizing antigen 43 (Ag43) autotransporter
  • Protein pI : 6.13
  • Protein Weight : 98576.16
  • Protein Length : 1180
  • Protein Note : Extended Signal Peptide of Type V secretion system; pfam13018
  • Protein Sequence : Show Sequence
    >YP_026164.1 CP4-44 prophage; self recognizing antigen 43 (Ag43) autotransporter [Escherichia coli str. K-12 substr. MG1655]
    MKRHLNTCYRLVWNHMTGAFVVASELARARGKRGGVAVALSLAAVTSLPVLAADIVVHPGETVNGGTLAN
    HDNQIVFGTTNGMTISTGLEYGPDNEANTGGQWVQDGGTANKTTVTSGGLQRVNPGGSVSDTVISAGGGQ
    SLQGRAVNTTLNGGEQWMHEGAIATGTVINDKGWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRGD
    AVRTTINKNGRQIVRAEGTANTTVVYAGGDQTVHGHALDTTLNGGYQYVHNGGTASDTVVNSDGWQIVKN
    GGVAGNTTVNQKGRLQVDAGGTATNVTLKQGGALVTSTAATVTGINRLGAFSVVEGKADNVVLENGGRLD
    VLTGHTATNTRVDDGGTLDVRNGGTATTVSMGNGGVLLADSGAAVSGTRSDGKAFSIGGGQADALMLEKG
    SSFTLNAGDTATDTTVNGGLFTARGGTLAGTTTLNNGAILTLSGKTVNNDTLTIREGDALLQGGSLTGNG
    SVEKSGSGTLTVSNTTLTQKAVNLNEGTLTLNDSTVTTDVIAQRGTALKLTGSTVLNGAIDPTNVTLASG
    ATWNIPDNATVQSVVDDLSHAGQIHFTSTRTGKFVPATLKVKNLNGQNGTISLRVRPDMAQNNADRLVID
    GGRATGKTILNLVNAGNSASGLATSGKGIQVVEAINGATTEEGAFVQGNRLQAGAFNYSLNRDSDESWYL
    RSENAYRAEVPLYASMLTQAMDYDRIVAGSRSHQTGVNGENNSVRLSIQGGHLGHDNNGGIARGATPESS
    GSYGFVRLEGDLMRTEVAGMSVTAGVYGAAGHSSVDVKDDDGSRAGTVRDDAGSLGGYLNLVHTSSGLWA
    DIVAQGTRHSMKASSDNNDFRARGWGWLGSLETGLPFSITDNLMLEPQLQYTWQGLSLDDGKDNAGYVKF
    GHGSAQHVRAGFRLGSHNDMTFGEGTSSRAPLRDSAKHSVSELPVNWWVQPSVIRTFSSRGDMRVGTSTA
    GSGMTFSPSQNGTSLDLQAGLEARVRENITLGVQAGYAHSVSGSSAEGYNGQATLNVTF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Vaccination of mice with recombinant passenger domains from either pAT or Ag43 afforded protection against intestinal colonization with ETEC (Harris et al., 2011).
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.918
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
23. FyuA
  • Gene Name : FyuA
  • Sequence Strain (Species/Organism) : Escherichia coli APEC O1
  • VO ID : VO_0010965
  • NCBI Gene ID : 4492541
  • NCBI Protein GI : 117624167
  • Locus Tag : APECO1_1063
  • Genbank Accession : CP000468
  • Protein Accession : YP_853080
  • Taxonomy ID : 405955
  • Gene Starting Position : 2119055
  • Gene Ending Position : 2121076
  • Gene Strand (Orientation) : +
  • Protein Name : pesticin/yersiniabactin receptor protein
  • Protein pI : 5.38
  • Protein Weight : 69187.33
  • Protein Length : 673
  • Protein Note : The gene fyuA encodes a 71 kDa outer-membrane protein FyuA (ferric yersiniabactin uptake). FyuA acts as a receptor for Fe-Ybt siderophore uptake (Hancock et al., 2008).
  • DNA Sequence : Show Sequence
    >NC_008563.1:2119055-2121076 Escherichia coli APEC O1, complete genome
    AATGAAAATGACACGGCTTTATCCTCTGGCCTTGGGGGGATTATTGCTCCCCGCCATTGCTAATGCCCAG
    ACTTCACAGCAAGACGAAAGCACGCTGGTGGTTACCGCCAGTAAACAATCTTCCCGCTCGGCATCAGCCA
    ACAACGTCTCGTCTACTGTTGTCAGCGCGCCGGAATTAAGCGACGCCGGCGTCACCGCCAGCGACAAACT
    CCCCAGAGTCTTGCCCGGGCTCAATATTGAAAATAGCGGCAACATGCTTTTTTCGACGATCTCGCTACGC
    GGCGTCTCTTCAGCGCAGGACTTCTATAACCCCGCCGTCACCCTGTATGTCGATGGCGTCCCTCAGCTTT
    CCACCAACACCATCCAGGCGCTTACCGATGTGCAAAGCGTGGAGTTGCTGCGAGGCCCACAGGGAACGTT
    ATATGGCAAAAGCGCTCAGGGCGGGATCATCAACATCGTCACCCAGCAGCCGGACAGTACGCCGCGCGGC
    TATATTGAAGGCGGCGTCAGTAGCCGCGACAGTTATCGAAGTAAGTTCAACCTGAGCGGCCCCATTCAGG
    ATGGCCTGCTGTACGGCAGCGTCACCCTGTTACGCCAGGTTGATGACGGCGACATGATTAACCCCGCGAC
    GGGAAGCGATGACTTAGGCGGCACCCGCGCCAGCATAGGGAATGTGAAACTGCGTCTGGCGCCGGACGAT
    CAGCCCTGGGAAATGGGCTTTGCCGCCTCACGCGAATGTACCCGCGCCACCCAGGATGCCTATGTGGGAT
    GGAATGATATTAAGGGCCGTAAGCTGTCGATCAGCGATGGTTCACCAGACCCGTACATGCGGCGCTGCAC
    TGACAGCCAGACCCTGAGTGGGAAATACACCACCGATGACTGGGTTTTCAACCTGATCAGCGCCTGGCAG
    CAGCAGCATTATTCGCGCGCCTTCCCTTCCGGTTCGTTAATCGTCAATATGCCTCAGCGCTGGAATCAGG
    ATGTGCAGGAGCTGCGCGCCGCAACCCTGGGCGATGCGCGTACCGTTGATATGGTGTTTGGGCTGTACCG
    GCAGAACACCCGCGAGAAGTTAAATTCAGCCTACGACATGCCGACAATGCCTTATTTAAGCAGTACCGGC
    TATACCACCGCTGAAACGCTGGCCGCATACAGTGACCTGACCTGGCATTTAACCGATCGTTTTGATATCG
    GCGGCGGCGTGCGCTTCTCGCATGATAAATCCAGTACACAATATCACGGCAGCATGCTCGGCAACCCGTT
    TGGCGACCAGGGTAAGAGCAATGACGATCAGGTGCTCGGGCAGCTATCCGCAGGCTATATGCTGACCGAT
    GACTGGAGAGTGTATACCCGTGTAGCCCAGGGATATAAACCTTCCGGGTACAACATCGTGCCTACTGCGG
    GTCTTGATGCCAAACCGTTCGTCGCCGAGAAATCCATCAACTATGAACTTGGCACCCGCTACGAAACCGC
    TGACGTCACGCTGCAAGCCGCGACGTTTTATACCCACACCAAAGACATGCAGCTTTACTCTGGCCCGGTC
    GGGATGCAGACATTAAGCAATGCGGGTAAAGCCGACGCCACCGGCGTTGAGCTTGAAGCGAAGTGGCGGT
    TTGCGCCAGGCTGGTCATGGGATATCAATGGCAACGTGATCCGTTCCGAATTCACCAATGACAGTGAGTT
    GTATCACGGTAACCGGGTGCCGTTCGTACCACGTTATGGCGCGGGAAGCAGCGTGAACGGCGTGATTGAT
    ACGCGCTATGGCGCACTGATGCCCCGACTGGCGGTTAATCTGGTCGGGCCGCATTATTTCGATGGCGACA
    ACCAGTTGCGGCAAGGCACCTATGCCACCCTGGACAGCAGCCTGGGCTGGCAGGCGACTGAACGGATGAA
    CATTTCCGTCTATGTCGATAACCTGTTCGACCGTCGTTACCGTACCTATGGCTACATGAACGGCAGCAGC
    GCCGTCGCGCAGGTCAATATGGGTCGCACCGTCGGTATCAATACGCGAATTGATTTCTTCTG
    
    
  • Protein Sequence : Show Sequence
    >YP_853080.1 pesticin/yersiniabactin receptor protein [Escherichia coli APEC O1]
    MKMTRLYPLALGGLLLPAIANAQTSQQDESTLVVTASKQSSRSASANNVSSTVVSAPELSDAGVTASDKL
    PRVLPGLNIENSGNMLFSTISLRGVSSAQDFYNPAVTLYVDGVPQLSTNTIQALTDVQSVELLRGPQGTL
    YGKSAQGGIINIVTQQPDSTPRGYIEGGVSSRDSYRSKFNLSGPIQDGLLYGSVTLLRQVDDGDMINPAT
    GSDDLGGTRASIGNVKLRLAPDDQPWEMGFAASRECTRATQDAYVGWNDIKGRKLSISDGSPDPYMRRCT
    DSQTLSGKYTTDDWVFNLISAWQQQHYSRAFPSGSLIVNMPQRWNQDVQELRAATLGDARTVDMVFGLYR
    QNTREKLNSAYDMPTMPYLSSTGYTTAETLAAYSDLTWHLTDRFDIGGGVRFSHDKSSTQYHGSMLGNPF
    GDQGKSNDDQVLGQLSAGYMLTDDWRVYTRVAQGYKPSGYNIVPTAGLDAKPFVAEKSINYELGTRYETA
    DVTLQAATFYTHTKDMQLYSGPVGMQTLSNAGKADATGVELEAKWRFAPGWSWDINGNVIRSEFTNDSEL
    YHGNRVPFVPRYGAGSSVNGVIDTRYGALMPRLAVNLVGPHYFDGDNQLRQGTYATLDSSLGWQATERMN
    ISVYVDNLFDRRYRTYGYMNGSSAVAQVNMGRTVGINTRIDFF
    
    
  • Molecule Role : Protective antigen
  • COG: COG1629P, under P: Inorganic ion transport and metabolism
  • Related Vaccine(s): E. coli vaccine based on recombinant protein FyuA
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.458
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
24. Hma
  • Gene Name : Hma
  • Sequence Strain (Species/Organism) : Escherichia coli CFT073
  • VO ID : VO_0010984
  • NCBI Gene ID : 1037732
  • NCBI Protein GI : 26248334
  • Locus Tag : c2482
  • Genbank Accession : AE014075
  • Protein Accession : NP_754374
  • Taxonomy ID : 199310
  • Gene Starting Position : 2322323
  • Gene Ending Position : 2324470
  • Gene Strand (Orientation) : +
  • Protein Name : outer membrane receptor for iron compound or colicin
  • Protein pI : 5.31
  • Protein Weight : 75008.63
  • Protein Length : 715
  • Protein Note : Escherichia coli O157:H7 ortholog: z3159
  • DNA Sequence : Show Sequence
    >NC_004431.1:2322323-2324470 Escherichia coli CFT073, complete genome
    AATGTTATATAATATACCTTGTCGAATTTATATCCTTTCCACTCTGTCATTATGCATTTCTGGGATAGTT
    TCTACTGCAACCGCAACTTCTTCAGAAACAAAAATCAGCAACGAAGAGACGCTCGTCGTGACCACGAATC
    GTTCGGCAAGCAACCTTTGGGAAAGCCCGGCGACTATACAGGTTATTGACCAACAAACATTGCAGAACTC
    CACCAATGCCTCCATAGCCGATAATTTGCAGGACATCCCCGGAGTAGAGATAACAGACAACTCCTTGGCA
    GGCCGTAAACAAATCCGCATTCGTGGCGAAGCATCCTCCCGTGTTTTAATTCTCATTGATGGTCAGGAGG
    TAACTTATCAGCGCGCCGGAGATAATTATGGTGTGGGACTGTTGATAGATGAGTCTGCGCTGGAGCGTGT
    TGAGGTAGTGAAAGGTCCATATTCCGTACTGTACGGTTCACAGGCAATTGGCGGTATTGTTAACTTCATA
    ACCAAAAAGGGAGGTGACAAACTTGCATCTGGAGTTGTGAAAGCTGTTTATAATTCCGCAACAGCAGGCT
    GGGAAGAATCAATCGCGGTCCAGGGGAGCATCGGTGGATTTGATTATCGCATCAACGGTAGTTATTCTGA
    TCAGGGCAATCGTGATACGCCGGATGGACGTCTGCCGAATACCAACTATCGTAACAATAGTCAGGGTGTA
    TGGTTGGGTTATAACTCCGGAAACCATCGTTTTGGCCTCTCGCTTGATCGCTACAGACTCGCGACGCAAA
    CTTACTATGAGGATCCAGACGGAAGCTATGAGGCATTTAGTGTCAAAATACCTAAACTTGAACGAGAGAA
    AGTTGGGGTATTCTATGACACAGACGTGGACGGTGACTATCTAAAAAAAATTCATTTCGACGCGTATGAG
    CAGACCATCCAGCGCCAATTTGCCAACGAAGTAAAAACGACACAGCCTGTTCCCAGTCCGATGATTCAGG
    CTCTGACCGTTCATAACAAGACTGACACCCATGATAAGCAATACACTCAGGCGGTCACATTGCAGAGTCA
    CTTTTCGCTGCCTGCTAATAATGAACTTGTTACCGGTGCACAGTACAAACAAGACAGGGTCAGCCAAAGG
    TCCGGTGGCATGACCTCAAGCAAATCTCTGACCGGCTTCATTAATAAGGAAACACGAACTCGCTCCTATT
    ATGAGTCAGAGCAAAGTACAGTCTCACTATTCGCACAAAATGACTGGCGATTCGCCGATCACTGGACATG
    GACAATGGGAGTTCGCCAATACTGGCTTTCTTCAAAGTTGACGCGTGGTGACGGAGTATCATATACCGCA
    GGCATTATAAGCGATACCTCTCTTGCCAGAGAGTCTGCGAGTGATCACGAAATGGTAACATCTACAAGCC
    TGCGCTATTCAGGTTTCGATAACTTGGAGTTACGCGCTGCGTTCGCGCAAGGCTACGTATTTCCCACACT
    CTCCCAGCTTTTTATGCAGACATCTGCGGGCGGCAGTGTCACATACGGAAATCCTGATCTTAAGGCTGAA
    CACTCCAATAACTTTGAATTAGGTGCACGATATAATGGTAATCAGTGGCTGATTGACAGCGCAGTTTACT
    ACTCAGAAGCTAAAGATTATATTGCAAGTCTGATCTGTGATGGCAGTATAGTTTGCAATGGTAACACCAA
    CTCCTCCCGTAGTAGCTACTATTATTATGACAATATTGATCGGGCAAAAACATGGGGACTGGAAATAAGC
    GCGGAATATAATGGCTGGGTTTTCTCGCCATATATCAGTGGCAATTTAATTCGTCGGCAATATGAAACTT
    CAACATTAAAAACAACTAATACAGGAGAACCAGCGATAAACGGACGTATAGGGCTGAAACATACTCTTGT
    GATGGGTCAGGCCAACATAATCTCTGATGTTTTTATTCGTGCTGCCTCTAGTGCAAAAGATGACAGTAAC
    GGTACCGAAACAAATGTTCCGGGCTGGGCCACTCTCAACTTTGCAGTAAATACAGAATTCGGTAACGAGG
    ATCAGTACCGGATTAACCTAGCACTCAATAACCTGACAGACAAACGCTACCGTACAGCACATGAAACTAT
    TCCTGCAGCAGGTTTTAATGCAGCTATAGGTTTTGTATGGAATTTCTG
    
    
  • Protein Sequence : Show Sequence
    >NP_754374.1 outer membrane receptor for iron compound or colicin [Escherichia coli CFT073]
    MLYNIPCRIYILSTLSLCISGIVSTATATSSETKISNEETLVVTTNRSASNLWESPATIQVIDQQTLQNS
    TNASIADNLQDIPGVEITDNSLAGRKQIRIRGEASSRVLILIDGQEVTYQRAGDNYGVGLLIDESALERV
    EVVKGPYSVLYGSQAIGGIVNFITKKGGDKLASGVVKAVYNSATAGWEESIAVQGSIGGFDYRINGSYSD
    QGNRDTPDGRLPNTNYRNNSQGVWLGYNSGNHRFGLSLDRYRLATQTYYEDPDGSYEAFSVKIPKLEREK
    VGVFYDTDVDGDYLKKIHFDAYEQTIQRQFANEVKTTQPVPSPMIQALTVHNKTDTHDKQYTQAVTLQSH
    FSLPANNELVTGAQYKQDRVSQRSGGMTSSKSLTGFINKETRTRSYYESEQSTVSLFAQNDWRFADHWTW
    TMGVRQYWLSSKLTRGDGVSYTAGIISDTSLARESASDHEMVTSTSLRYSGFDNLELRAAFAQGYVFPTL
    SQLFMQTSAGGSVTYGNPDLKAEHSNNFELGARYNGNQWLIDSAVYYSEAKDYIASLICDGSIVCNGNTN
    SSRSSYYYYDNIDRAKTWGLEISAEYNGWVFSPYISGNLIRRQYETSTLKTTNTGEPAINGRIGLKHTLV
    MGQANIISDVFIRAASSAKDDSNGTETNVPGWATLNFAVNTEFGNEDQYRINLALNNLTDKRYRTAHETI
    PAAGFNAAIGFVWNF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A vaccine made by Hma from E. coli strain CFT073 and 536 induced protection to the infection of virulent strain CFT073 and 536, respectively, in the bladder in the CBA/J mice. (Alteri et al., 2009).
  • COG: COG4771P, under P: Inorganic ion transport and metabolism
  • Related Vaccine(s): E. coli Hma protein vaccine
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.770
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
25. ireA
  • Gene Name : ireA
  • Sequence Strain (Species/Organism) : Escherichia coli CFT073
  • VO ID : VO_0010985
  • NCBI Gene ID : 1037614
  • NCBI Protein GI : AMR36194
  • Locus Tag : c5174
  • Genbank Accession : AE014075
  • Protein Accession : NP_757022
  • Other Database IDs : CDD:139605
  • Taxonomy ID : 562
  • Gene Starting Position : 4935989
  • Gene Ending Position : 4938037
  • Gene Strand (Orientation) : +
  • Protein Name : IreA
  • Protein pI : 6.54
  • Protein Weight : 71893.67
  • Protein Length : 729
  • Protein Note : putative iron-regulated outer membrane virulence protein; Provisional
  • DNA Sequence : Show Sequence
    >NC_004431.1:4935989-4938037 Escherichia coli CFT073, complete genome
    TATGAAGAACAAATATATCATTGCTCCGGGCATTGCCGTGATGTGTTCTGCAGTTATATCATCAGGTTAT
    GCCAGTTCTGATAAAAAAGAAGATACGCTTGTTGTTACTGCCTCCGGGTTCACTCAGCAGCTCAGAAATG
    CCCCGGCCAGTGTCTCAGTCATTACTTCAGAACAACTGCAAAAAAAACCGGTTTCAGATCTGGTCGATGC
    AGTAAAAGATGTTGAAGGGATTAGTATCACTGGTGGGAATGAAAAACCGGATATCAGTATACGTGGTCTA
    AGTGGCGATTACACGCTGATTCTGGTCGATGGACGACGTCAGAGCGGTCGGGAATCCAGACCAAACGGCA
    GCGGCGGTTTTGAAGCCGGATTTATCCCTCCTGTGGAAGCAATTGAACGCATTGAAGTGATCCGTGGCCC
    TATGTCTTCCCTGTATGGTTCTGATGCCATCGGAGGGGTCATTAATATCATAACCAAACCAGTTAATAAC
    CAAACATGGGATGGCGTACTTGGACTTGGGGGGATTATTCAGGAACATGGGAAATTTGGTAACTCAACCA
    CAAATGACTTCTATCTGTCAGGCCCATTGATTAAGGATAAACTTGGTCTTCAGCTATATGGAGGAATGAA
    CTATCGCAAGGAAGATAGTATCTCTCAGGGAACACCGGCAAAAGATAATAAGAATATAACGGCAACGCTC
    CAGTTTACTCCGACTGAAAGCCAGAAGTTTGTTTTTGAATATGGAAAAAATAACCAGGTGCATACATTAA
    CACCTGGTGAGTCTCTCGATGCCTGGACTATGCGGGGAAATCTTAAACAACCAAACAGTAAAAGAGAAAC
    GCATAATTCACGTAGTCACTGGGTAGCAGCATGGAATGCCCAGGGCGAAATACTGCATCCTGAAATTGCT
    GTTTATCAGGAGAAAGTTATTCGTGAGGTTAAATCAGGTAAAAAAGATAAATATAATCATTGGGATCTTA
    ATTACGAGTCAAGAAAACCGGAAATAACCAACACAATCATAGATGCAAAAGTGACGGCATTTCTGCCGGA
    AAATGTACTGACCATCGGAGGTCAATTTCAGCATGCAGAGCTCCGTGATGACTCAGCCACGGGTAAAAAA
    ACGACAGAAACACAGTCTGTTTCAATTAAACAGAAAGCTGTTTTTATAGAAAATGAATATGCAGCAACGG
    ATTCTCTCGCCCTGACTGGAGGACTGCGTCTCGATAATCATGAAATCTATGGCAGTTACTGGAATCCAAG
    ATTGTACGCTGTTTATAACCTGACCGATAATCTCACACTCAAAGGGGGGATCGCAAAAGCATTTCGGGCT
    CCTTCAATTCGTGAGGTGAGTCCTGGATTTGGAACACTGACGCAGGGTGGTGCCTCTATTATGTATGGAA
    ACAGGGACCTGAAACCGGAGACCAGTGTAACCGAAGAGATCGGTATTATTTATAGTAATGATAGTGGTTT
    TTCGGCGAGCGCGACGCTGTTTAATACTGATTTTAAAAATAAGTTGACCAGTTACGATATAGGTACAAAA
    GATCCAGTCACCGGGTTAAACACTTTTATTTATGATAATGTAGGTGAGGCAAATATCAGAGGGGTGGAGC
    TTGCAACTCAGATTCCTGTGTATGATAAATGGCATGTATCTGCAAACTATACATTTACTGACTCTCGTCG
    AAAAAGTGATGACGAAAGTCTCAATGGCAAGTCGCTGAAAGGGGAACCTCTGGAAAGAACTCCCAGACAT
    GCAGCCAATGCAAAACTGGAATGGGATTACACTCAGGATATTACATTTTATTCATCTCTGAATTATACGG
    GAAAACAAATCTGGGCAGCACAAAGAAATGGTGCTAAGGTTCCCCGCGTTCGTAATGGATTCACATCTAT
    GGATATTGGTCTAAATTACCAGATTCTGCCAGACACGCTGATTAATTTTGCCGTTCTTAACGTCACAGAC
    AGAAAGAGCGAGGATATCGATACCATTGATGGTAACTGGCAGGTCGATGAAGGACGCCGTTATTGGGCTA
    ATGTAAGAGTATCCTTCTG
  • Protein Sequence : Show Sequence
    >AMR36194.1 IreA [Escherichia coli]
    MKNKYIIAPGIAVMCSAVISSGYASSDKKEDTLVVTASGFTQQLRNAPASVSVITSEQLQKKPVSDLVDA
    VKDVEGISITGGNEKPDISIRGLSGDYTLILVDGRRQSGRESRPNGSGGFEAGFIPPVEAIERIEVIRGP
    MSSLYGSDAIGGVINIITKPVNNQTWDGVLGLGGIIQEHGKFGNSTTNDFYLSGPLIKDKLGLQLYGGMN
    YRKEDSISQGTPAKDNKNITATLQFTPTESQKFVFEYGKNNQVHTLTPGESLDAWTMRGNLKQPNSKRET
    HNSRSHWVAAWNAQGEILHPEIAVYQEKVIREVKSGKKDKYNHWDLNYESRKPEITNTIIDAKVTAFLPE
    NVLTIGGQFQHAELRDDSATGKKTTETQSVSIKQKAVFIENEYAATDSLALTGGLRLDNHEIYGSYWNPR
    LYAVYNLTDNLTLKGGIAKAFRAPSIREVSPGFGTLTQGGASIMYGNRDLKPETSVTEEIGIIYSNDSGF
    SASATLFNTDFKNKLTSYDIGTKDPVTGLNTFIYDNVGEANIRGVELATQIPVYDKWHVSANYTFTDSRR
    KSDDESLNGKSLKGEPLERTPRHAANAKLEWDYTQDITFYSSLNYTGKQIWAAQRNGAKVPRVRNGFTSM
    DIGLNYLILPDTLINFAVLNVTDRKSEDIDTIDGNWQVDEGRRYWANVRVSF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Immunization with IreA protects against urinary tract colinization by E.coli CFT073 and reduces colinization by E.coli 536 in the bladder of CBA/J mice (Alteri et al., 2009).

    We demonstrated for IreA, antigen-specific serum IgG represents a strong correlate of protection in vaccinated mice (Mobley and Alteri, 2015).
  • COG: COG4771P, under P: Inorganic ion transport and metabolism
  • Related Vaccine(s): E. coli IreA protein vaccine
  • Localization(Probability): Outer Membrane
    (Prob.=0.993)
  • Adhesin Probability: 0.430
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
26. IroN
  • Gene Name : IroN
  • Sequence Strain (Species/Organism) : Escherichia coli
  • VO ID : VO_0010988
  • NCBI Gene ID : 7379404
  • NCBI Protein GI : 222104801
  • Locus Tag : MM1_0014
  • Genbank Accession : AF449498
  • Protein Accession : YP_002539290
  • 3D structure: PDB ID : 1FEP
  • Taxonomy ID : 562
  • Plasmid No : pAPEC-1
  • Gene Starting Position : 9647
  • Gene Ending Position : 11824
  • Gene Strand (Orientation) : -
  • Protein Name : outer membrane receptor FepA
  • Protein pI : 5.85
  • Protein Weight : 74767.07
  • Protein Length : 725
  • Protein Note : Fep; Cbt; Cbr; FeuB; FepA; PfeA; IroN; BfeA; outer membrane receptor of ferric enterobactin and colicins B and D; interacts with the TonB-ExbBD complex which catalyzes the translocation of the siderophore to the periplasmic space
  • DNA Sequence : Show Sequence
    >NC_011980.1:9647-11824 Escherichia coli chi7122 plasmid pAPEC-1, complete sequence
    ATCAGAATGATGCGGTAACTCCGGCATAGTAAGCCCGGCCTGGCTCGTTATAGGTATTCGCCCCTTCAGA
    AGATCGGAAGATCTGTTTATTGAGGATATTACTGACGCCGACATTAAGACGCAGATTTTTATTAATATCG
    TAATTGAAGTTCGTCCCCACCAGTGAATAAGCGCCCAGCTCTTTACCTGACAGACCGCCAGTATCTTCAC
    TGCGGGTTTCCGCATGAGTACGCGGTTTTTGTCTGCCATATAACGTCCAGTTGACGCTGGCAGAAAACGC
    CTGGGTGATGGTCCAGTTAAGCGAGTTATTGATAGTATATTTCGGGATGACCGACAGAGGATTACCGGTG
    TCTTTTTGCTCCGAAGTGATCATCCATGTGGCATTGGTATTCCAGTTCAGACGATCTTTCACCAGTGGGA
    AAGACATACTGGCTTCGATACCGTCCACCAGAGCTTTCCCGCCATTCTGCCACTTGAGGATATATGCGCC
    TGAAGCGGTTTGCCCGATAACGTTATCCCCGGCCACGATCTTATTCTGGTAATCATTGCGGAAGTAGGTC
    ACACTTGCGTGGTAATCTTCCCAGGTGAACTCCAGCCCAATTTCTTTATTGACGCTGATTTCCGGATCGA
    GATCTTTATTACCGATCAGGTAGCACCCGCCTGATGTAATATCTTTTGGACAGCCATTGCCTTTCGAGTA
    GAGCAGATAGCCTTCACTGGATTGATACAGGTTTGGGGCTTTAAAGGTTCGGGCAACCCCTGCTTTGACT
    TTGAAATAATCGCCCAATTCCTGCGAAAGATTCAGACTGGGGCTGAAGTTCCCGCCGGAGTCGCTGAGAT
    AATCAAAGCGCAGGCCGGGAATGATATTCGTGCCAGGAACCGGCTCAATGTTATCTTCAATATACAGCGC
    ACTGATTTGAGAATGATTTTTACTGCTGCGATCCGCAGCAGAGCCAGAAATACCGCTGATATCACTGTCA
    TTCACCGTCAGGCTGGTAGAGGAAGGATCATCGAGCTTATCGCGGTTCCACTCTGCACCAACGGTCAGCG
    TTTGATCAACCATCACATTCAAAGGAATATTAAGCTCGCCGCTGGTTCGCCAGGAACTCAGGCGATTGGT
    CGTAAACTTTTCACCCGCTAAAATACGCCCTTCACCACCGCCGGATAATCCTTCATTCATGCGGGTATTA
    TTGGTTTTCTCGTAATAAACACCAAAGCGACTTTGTCCCCAGTCCCAGATACCATTATGCGTAATGCCAT
    AATTCTGTCGGTACAGGCGGTTCGTCTCTTTGCCGGATTTTGCCAGGCTTTCGGTAACTGCACTGGAAGA
    ACTGTTTTGCGTATCGCCCGCATAGATATTCCCCTGGCGGCTATATCCGGCTTCGAAATCGAGAATCTGC
    TGCGGATTTAATTTCCACGAGACAACGCCGTTAATATCTTTGTTACGTACCCCTTCATGCCCGGCTGCGT
    TTTTCGTACCGACCGGAGAATTAATATCCCAACTGTCAGCATCCGTTTTATTCAGGTTACCATACAAACG
    CGTGGTAAGAGCATTACCAGCCAGAGGCCCACTAAGGCTGAAATTGGCGCGACGCGTAGCGCCCTCATCG
    CTACTTTCCGGCTGATTGGTGTATAACGACAGCGAACCGTGCCAGTCGTTGGTGGGACGTTTGGTAATGA
    TGTTCACCACCCCCCCGGCTGCCCCCGAACCGTAGCGCGCCGCCGCAGGGCCGCGGATCACTTCAATACG
    CTCAACCTGTTCCGGTGGCACCCAGTTGGTGTCACCGCGGGTATCACGCTCTCCACGCCAGCTATAACGC
    ACGGAGTTACGTGACGTCACCGGTACACCATCAATTAAAATTAAGGTGTTTTCCGGCCCCATACCACGAA
    TATCGATCTGGCGGTTGTTACCGCGTGTGCCCGAGGCGCTATTGCCGGTAAGATTGACGCCAGGCATTTT
    ACGAATAATATCTGAAAGGTCGTTTACCGGAGGGGTCTTTTTAATATCCTCGCTGGTAATAACCGACACG
    CCCGGCTGCTGTTTTAATACCTGCTCAGCGGTGGCTTCCACCACCAGAGTCTCGTCATTATCATCGTCGG
    AGGATTTGGCTACTGATACCTGGCTATTCAACCCAACCAGGAGCACAGTTAGCGACCAGAGGATTTTGTT
    AATTCTCA
    
    
  • Protein Sequence : Show Sequence
    >YP_002539290.1 IroN, siderophore receptor (plasmid) [Escherichia coli chi7122]
    MRINKILWSLTVLLVGLNSQVSVAKSSDDDNDETLVVEATAEQVLKQQPGVSVITSEDIKKTPPVNDLSD
    IIRKMPGVNLTGNSASGTRGNNRQIDIRGMGPENTLILIDGVPVTSRNSVRYSWRGERDTRGDTNWVPPE
    QVERIEVIRGPAAARYGSGAAGGVVNIITKRPTNDWHGSLSLYTNQPESSDEGATRRANFSLSGPLAGNA
    LTTRLYGNLNKTDADSWDINSPVGTKNAAGHEGVRNKDINGVVSWKLNPQQILDFEAGYSRQGNIYAGDT
    QNSSSSAVTESLAKSGKETNRLYRQNYGITHNGIWDWGQSRFGVYYEKTNNTRMNEGLSGGGEGRILAGE
    KFTTNRLSSWRTSGELNIPLNVMVDQTLTVGAEWNRDKLDDPSSTSLTVNDSDISGISGSAADRSSKNHS
    QISALYIEDNIEPVPGTNIIPGLRFDYLSDSGGNFSPSLNLSQELGDYFKVKAGVARTFKAPNLYQSSEG
    YLLYSKGNGCPKDITSGGCYLIGNKDLDPEISVNKEIGLEFTWEDYHASVTYFRNDYQNKIVAGDNVIGQ
    TASGAYILKWQNGGKALVDGIEASMSFPLVKDRLNWNTNATWMITSEQKDTGNPLSVIPKYTINNSLNWT
    ITQAFSASVNWTLYGRQKPRTHAETRSEDTGGLSGKELGAYSLVGTNFNYDINKNLRLNVGVSNILNKQI
    FRSSEGANTYNEPGRAYYAGVTASF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Active immunization of BALB/c mice with IroN antigen in Freund's adjuvant protects mice from lethal challenge with ExPEC strain S26 (Durant et al., 2007).
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.688
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
27. Iss
  • Gene Name : Iss
  • Sequence Strain (Species/Organism) : Escherichia coli APEC O1
  • VO ID : VO_0010964
  • NCBI Gene ID : 5616654
  • NCBI Protein GI : 157418230
  • Locus Tag : APECO1_O1CoBM146
  • Genbank Accession : DQ381420
  • Protein Accession : YP_001481302
  • Taxonomy ID : 405955
  • Plasmid No : pAPEC-O1-ColBM
  • Gene Starting Position : 126236
  • Gene Ending Position : 126544
  • Gene Strand (Orientation) : -
  • Protein Name : Iss
  • Protein pI : 8.5
  • Protein Weight : 10271.09
  • Protein Length : 102
  • DNA Sequence : Show Sequence
    >NC_009837.1:126236-126544 Escherichia coli APEC O1 plasmid pAPEC-O1-ColBM, complete sequence
    ACTATTGTGAGCAATATACCCGGGCTTCCAGCGGAGTATAGATGCCAAAAGTGATAAAACCGAGCAATCC
    ATTTACGAATGTTTGCTGAGTTTCTGTTTTAACAACATTTTCTGCACCGCCACAAATTTTGGCTGCATCA
    ACAGTTTTCTCTTGTCCAATTCCCGAAACGAAGAAATGATGAGTGATGGTTTCCTTTGGTGTTACTGCTG
    TCGGTTTGTTTCCAACAGTAAACGTTTGTTGAGCACATCCTGTAATAAGCATTGCCAGAGCGGCAGAAAA
    TAACATTTTTTTCATCTTATTATCCTGCA
    
    
  • Protein Sequence : Show Sequence
    >YP_001481302.1 Iss (plasmid) [Escherichia coli APEC O1]
    MQDNKMKKMLFSAALAMLITGCAQQTFTVGNKPTAVTPKETITHHFFVSGIGQEKTVDAAKICGGAENVV
    KTETQQTFVNGLLGFITFGIYTPLEARVYCSQ
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): APEC vaccine using GST-Iss fusion protein
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.604
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
28. iutA
  • Gene Name : iutA
  • Sequence Strain (Species/Organism) : Escherichia coli CFT073
  • VO ID : VO_0010986
  • NCBI Gene ID : 1039578
  • NCBI Protein GI : WP_000079029
  • Locus Tag : c3623
  • Genbank Accession : AE014075
  • Protein Accession : NP_755498
  • Other Database IDs : CDD:273805
  • Taxonomy ID : 562
  • Gene Starting Position : 3461192
  • Gene Ending Position : 3463471
  • Gene Strand (Orientation) : -
  • Protein Name : TonB-dependent receptor
  • Protein pI : 5.01
  • Protein Weight : 80196.59
  • Protein Length : 830
  • Protein Note : TonB-dependent siderophore receptor; TIGR01783
  • DNA Sequence : Show Sequence
    >NC_004431.1:3461192-3463471 Escherichia coli CFT073, complete genome
    GTCAGAACAGCACTGAGTAGTTCAGACCAAAGGTTCGGCCCCGGCCTTTGTAGTCGTACAGTGAAGCAGG
    GCCGTAACCCGGGCTGTAGTACAGAGGTGCACGCTGTCCCCAGACAGTGGTATAGTCACGGTCGAAGAGG
    TTCTCAACGCTGAAGCTGAGTGTTCCCACCGGAAGCTGCCAACTACTGATAAAATCGACGGTAGTGTAAC
    CATTAATATCGTTACCCTCTGCATCGCTTACGTCGAAAGAAGTGGTGCTCTGTACACGCAGACTCCACGG
    TTCCGGCGCCCAGTTAATGTAAGCTGTCGCTTTCGATGGACTTGATTCCTTCACGTCATATTTTTGCCAT
    TGACCGTTCACTTTCGACTCGGTTTTCAGCACATTGAAGTTCACACCGGTACTCCAGTCAGTATCCGGGA
    TCAGGTAGTCCACCGCACCTTCCACGCCGTAAATACGGCGCCTGTCGTCCTTCACACTGATGGTCAGATC
    TTTATTCCTTTCCACGCTCTTATTGGAAAGCGAGTAATATGCCGCGATTTGAGTCCGCAGGTTGTCACCG
    GTAAAGCGCCAGCCCAGTTCATAAGAATCGACTTTCACGCCTTCCAGCTTACTGTCGCTGACGTTCACGC
    TCTTTGTCAGGGGAAGATGGCCGTTCACTGCTGCACCATAGATGCCGCGACCATAATATTTCCCCGGATC
    CGGCAATGCCACCCCCTGGGAAAAATTGAACCATGCCTGCTGACGTTCGGTGATGTGCATCAGCAGACCA
    GCATTGAACAGAAAGTTATCGTAATCTACCGAACCACCAGGAATGGCGTCGGCAGATATCGCCTTCCCGG
    CAGCAATCTTCTGTTGCTGCGTGTAGTCGATGAAATCATCTACCCTGTTCTCAGTATACTGATAGCGTAC
    GCCACCGCTAACGGTAAAAATATCATTAATGTCATAGCTGGATTGCAGGAAGGCCGCCAGATTGGTGATG
    TCATATGACGGATAGCGCCCGGTGGTGTAAATCTTATGGTTGTTCAGCCCTCCGGAAGCACTTGCCTGAG
    CCAGATCGAAGAACATCTGGTTGGAGGTAAAGCGCTCATGCTCAGCATCCAGCCCCCAGGTGATTTGCCA
    GCCGTCCATAAGTTGGCTGTTCAGAGTCAGTTTCATGCCGTACTGGTCGGTATCCTGCTGTGACGAGGAG
    AAAGCCGTCGCCTGTTTATTCGCATTTACCGTCGGGAACGGGTAGAACCGCAACGACTCATCGCGGTAGT
    AAACCTGACCGACCAGTTCCTGTCTCAGGAAATCACTGTCAGAGTACTGCAGGCTGATCAAATGCCGCTC
    AGTGCCGGGAATGCGGTCAGAATTCAGCCCCTTACTGACGTATGGTGTGCTGCTCCCGCTGATGGCGGAA
    AAGCCTTTCCCGAGATTAAGCCCGTAATTGTCGTCCCCCTGACTTTTATAGTACTGCGTTATCAGTTGAA
    GCTGCCGGGATTCATCGATGTTCAGCGTACCGGTTCCCATGATGTCCAGCCGATTGGAGTGCTGCAGGCC
    GGTCTGGGTGTTATCAAGCAGGGTGGCATCGCCGTTACCGTCAAACCAGCCGCCAAATTTCTGATATGCC
    ACGGAAAGACGTCCGGAGATATGGTCATTTCCGCCGGAGACAGCACCGGCAATGCGCTCATCGTGATCTT
    TACTGCTGTTAAAGCCACTTTTTGTGCCAGCCTCAAACTCCATCATGGTTTCCGGCTGGCCTTTTTTGGT
    CACGATGTTGATCAACCCTCCGGTACTCCCGCCACCGTACAGGGCCGTCGCGCCGGAGATCACTTCAATA
    TGGTCGATATTAAAAGGATCGACAGAGTCCAGTTGTCGGCTGTCGGAACGTGAAGAGTTGAGGCGCACAC
    CGTCAATCAGGACAACCAGCGGGCGGCCACGCATGTTCATACCGTAGTTGGTTCGGCTCTGGCTGCTGAC
    ATCAAGGCCGGGGATTAACTGAGCCAGTGCGTCTTTCAGCTCTTTACCGCCCTGAATCTGCTGCTCCAGT
    TCGGCATTTTCGATAACCCAGGTGGTTTGCGCCATCTCCGCTACAGTTCGATTGCTGCGGCTGGCAGACA
    CTATGATCTCATTATCATCGTTTTGCTGGGCGACAGCTGGTGACAGCACGACAAGAAGCAGCGGACCAAG
    AGCCCGGGGCATATACTTTTTGCGCATCATCGTTATTCCTGAATATTTGTTGTATAGTGAGTTAAAGCAG
    CAGCCTCCGGCTGCGGTTTTTTCCGGCTGCCGCTGCGCCA
  • Protein Sequence : Show Sequence
    >WP_000079029.1 TonB-dependent receptor [Escherichia coli]
    MAQRQPEKTAAGGCCFNSLYNKYSGITMMRKKYMPRALGPLLLVVLSPAVAQQNDDNEIIVSASRSNRTV
    AEMAQTTWVIENAELEQQIQGGKELKDALAQLIPGLDVSSQSRTNYGMNMRGRPLVVLIDGVRLNSSRSD
    SRQLDSVDPFNIDHIEVISGATALYGGGSTGGLINIVTKKGQPETMMEFEAGTKSGFNSSKDHDERIAGA
    VSGGNDHISGRLSVAYQKFGGWFDGNGDATLLDNTQTGLQHSNRLDIMGTGTLNIDESRQLQLITQYYKS
    QGDDNYGLNLGKGFSAISGSSTPYVSKGLNSDRIPGTERHLISLQYSDSDFLRQELVGQVYYRDESLRFY
    PFPTVNANKQATAFSSSQQDTDQYGMKLTLNSQLMDGWQITWGLDAEHERFTSNQMFFDLAQASASGGLN
    NHKIYTTGRYPSYDITNLAAFLQSSYDINDIFTVSGGVRYQYTENRVDDFIDYTQQQKIAAGKAISADAI
    PGGSVDYDNFLFNAGLLMHITERQQAWFNFSQGVALPDPGKYYGRGIYGAAVNGHLPLTKSVNVSDSKLE
    GVKVDSYELGWRFTGDNLRTQIAAYYSLSNKSVERNKDLTISVKDDRRRIYGVEGAVDYLIPDTDWSTGV
    NFNVLKTESKVNGQWQKYDVKESSPSKATAYINWAPEPWSLRVQSTTSFDVSDAEGNDINGYTTVDFISS
    WQLPVGTLSFSVENLFDRDYTTVWGQRAPLYYSPGYGPASLYDYKGRGRTFGLNYSVLF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Immunization with IutA protects against urinary tract colinization by E.coli CFT073 in the bladders of CBA/J mice (Alteri et al., 2009).

    We demonstrated for IutA, antigen-specific serum IgG represents a strong correlate of protection in vaccinated mice (Mobley and Alteri, 2015).
  • COG: COG1629P, under P: Inorganic ion transport and metabolism
  • Related Vaccine(s): E. coli IutA protein vaccine
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.612
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
29. MipA
  • Gene Name : MipA
  • Sequence Strain (Species/Organism) : Escherichia coli O25b:H5
  • NCBI Protein GI : ANK01746
  • Other Database IDs : CDD:226236
  • Taxonomy ID : 941280
  • Gene Strand (Orientation) : ?
  • Protein Name : mipA
  • Protein pI : 5.94
  • Protein Weight : 26992.92
  • Protein Length : 297
  • Protein Note : Outer membrane protein
  • Protein Sequence : Show Sequence
    >ANK01746.1 mipA [Escherichia coli O25b:H4]
    MTKLKLLALGVLIATSAGVAHAEGKFSLGAGVGVVEHPYKDYDTDVYPVPVINYEGDNFWFRGLGGGYYL
    WNDATDKLSITAYWSPLYFKAKDSGDHQMRHLDDRKSTMMAGLSYAHFTQYGYLRTTLAGDTLDNSNGIV
    WDMAWLYRYTNGGLTVTPGIGVQWNSENQNEYYYGVSRKESARSGLRGYNPNDSWSPYLELSASYNFLGD
    WSVYGTARYTRLSDEVTDSPMVDKSWTGLISTGITYKF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : In intranasal challenge assays of mice, immunization with ETEC_2479 protected 88% of mice from an otherwise lethal challenge with ETEC H10407. Immunization with MipA provided an intermediate degree of protection of 64% (Kumar et al., 2015)
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.879
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
30. ompA
  • Gene Name : ompA
  • Sequence Strain (Species/Organism) : Escherichia coli CFT073
  • VO ID : VO_0010991
  • NCBI Gene ID : 1039252
  • NCBI Protein GI : WP_001246526
  • Locus Tag : c3389
  • Genbank Accession : AE014075
  • Protein Accession : NP_755264
  • Other Database IDs : CDD:225439
    CDD:143586
  • Taxonomy ID : 562
  • Gene Starting Position : 3227151
  • Gene Ending Position : 3228803
  • Gene Strand (Orientation) : +
  • Protein Name : OmpA family protein
  • Protein pI : 8.72
  • Protein Weight : 55874.8
  • Protein Length : 614
  • Protein Note : Outer membrane protein OmpA and related peptidoglycan-associated (lipo)proteins [Cell wall/membrane/envelope biogenesis]; COG2885
  • DNA Sequence : Show Sequence
    >NC_004431.1:3227151-3228803 Escherichia coli CFT073, complete genome
    AGTGAGGAACACGCTGAAACAGGCCATCGTGCTGTGGGGAATGGTGTTACTGCTGGTGCTGTGGTCAGTG
    TTTATCAGTCCGTCTGGCGTGCTGAGATGGGCCGGTGCGGCGGCTATCGTTCTGGCGGTTGCCGCGTTGT
    TGATTTATCGGCGCAGGCAGGCGTGGACGGAGATGACCGGCGATGCCGGGTTGTCATCGCTGCCGCCGGA
    AACCTACCGACAGCCGGTAGTGCTGGTCTGTGGCGGTCTGTCGGCGCACCTGTCCACTGACAGCCCGGTC
    CGCCAGGTTTCAGAAGGGCTGTATCTGCATGTTCCTGATGAAGAACAGCTTGTGGCGCAGGTGGAGCGAT
    TGCTGACCCTTCGCCCGGCGTGGGCATCGCAGCTTGCCGTGGCGTATACCATCATGCCCGGCATACACCG
    GGATGTGGCGGTTCTGGCCGGACGGCTGCGACGGTTCGCCCACAGTATGGCGACGGTGCGTCGTCGGGCA
    GGCGTAAACGTCCCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCGTTGCCGGAAAGAGCGAGTTCAC
    CGTGGTTTATCTGTACCGGCGGCGAAGTTCAGGTAGCAACATCCACAGAGACCACCATGCCCGCGCAGTG
    GATTGCACAATCCGGCGTACAGGAGCGCAGTCAGCGACTCTGTTACCTGCTGAAAGCTGAAAGCCTGATG
    CAGTGGCTGAATCTTAATGTGCTGACGGCACTGAACGGCCCGGAGGCGAAATGTCCACCACTGGCGATGA
    CCGTGGGGCTGGTCCCCTCGTTGCCTGCGGTGGATAACAACCTGTGGCAGTTGTGGATCACCGCCAGAAC
    CGGCCTGACGCCGGATATCGCGGACACCGGCACAGACGATGCGCTGCCATTCCCGGATGCCCTGTTACGG
    CAGTTGCCGCGTCAGTCGGGCTTTACCCCGCTGCGACGAGCCTGCGTGACCATGCTGGGCGTCACCACCG
    TGGCGGGTATCGCCGCGCTGTGCCTGTCAGCCACGGCAAATCGCCAGTTATTACGGCAGGTCGGTGACGA
    TCTGCACCGGTTTTATGCCGTCCCGGTGGAGGAATTTATCACCAAAGCCCGTCACCTGTCGGTGCTGAAA
    GACGATGCGACCATGCTCGATGGGTATTACCGGGAAGGAGAACCCCTGCGCCTCGGTCTGGGGTTATACC
    CCGGCGAACGCATCCGCCAGCCGGTATTACGCGCCATTCGCGACTGGCGTCCGCCTGAACAAAAAATGGA
    GGTGACGGCTTCGCTTCAGGTTCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCC
    CGCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGACGCACTGGTGAACATCCGGGCAAAACCGGGCTGGC
    TGATCCTCGTGGCCGGATATACCGATGCCACCGGCGATGAAAAAAGCAATCAGCAGTTATCGCTGCGGCG
    TGCCGAAGCGGTGCGCAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGA
    CTGGGCGAGAGCCAGCCTGCGGCGACCAACGACACGCCACAGGGCCGGGCAGTCAACCGGCGTGTCGAAA
    TCAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATA
  • Protein Sequence : Show Sequence
    >WP_001246526.1 OmpA family protein [Escherichia coli]
    MRNTLKQAIVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTGDAGLSSLPPE
    TYRQPVVLVCGGLSAHLSTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTLRPAWASQLAVAYTIMPGIHR
    DVAVLAGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPERASSPWFICTGGEVQVATSTETTMPAQW
    IAQSGVQERSQRLCYLLKAESLMQWLNLNVLTALNGPEAKCPPLAMTVGLVPSLPAVDNNLWQLWITART
    GLTPDIADTGTDDALPFPDALLRQLPRQSGFTPLRRACVTMLGVTTVAGIAALCLSATANRQLLRQVGDD
    LHRFYAVPVEEFITKARHLSVLKDDATMLDGYYREGEPLRLGLGLYPGERIRQPVLRAIRDWRPPEQKME
    VTASLQVQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
    AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Active immunization of BALB/c mice with recombinant E. coli protein C3389 antigen in Freund's adjuvant protects mice from lethal challenge with ExPEC strain S26 (Durant et al., 2007).

    recombinant antigens (rAg) vaccine combining common ExPEC surface proteins EtsC, OmpA, OmpT, and TraT showed significantly (P < 0.05) elicited IgY against specific antigens, induced immune related mRNA expression in the spleen and bursa, reduced in vitro growth of multiple APEC serotypes, and decreased bacterial loads in the heart and spleen, and gross lesion scores of the air sac, heart and liver in chickens. (Van et al., 2017)
  • COG: COG2885M, under M: Cell wall/membrane/envelope biogenesis
  • Related Vaccine(s): E. coli C3389 protein vaccine
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=0.981)
  • Adhesin Probability: 0.279
  • Trans-membrane helices: 3
  • Detailed Vaxign Results Vaxign Results
31. ompC
  • Gene Name : ompC
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : AYG18759
  • Other Database IDs : CDD:182543
  • Taxonomy ID : 511145
  • Gene Strand (Orientation) : ?
  • Protein Name : porin OmpC
  • Protein pI : 4.39
  • Protein Weight : 38727.09
  • Protein Length : 441
  • Protein Note : obtained from culture collection
  • Protein Sequence : Show Sequence
    >AYG18759.1 porin OmpC [Escherichia coli str. K-12 substr. MG1655]
    MKVKVLSLLVPALLVAGAANAAEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQ
    LTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDN
    FMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYE
    GFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNF
    EAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRD
    AGINTDNIVALGLVYQF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : After challenge with 2.5 × 107 CFU (5 × LD50) of the highly virulent ExPEC strain PCN033, 62.5% protection was observed in mice immunized with OmpC (Liu et al., 2012).
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.687
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
32. ompF
  • Gene Name : ompF
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : APB87310
  • Other Database IDs : CDD:236639
    CDD:238208
  • Taxonomy ID : 562
  • Protein Name : OmpF
  • Protein pI : 4.49
  • Protein Weight : 37197.72
  • Protein Length : 405
  • Protein Note : outer membrane protein F; Provisional
  • Protein Sequence : Show Sequence
    >APB87310.1 OmpF [Escherichia coli]
    MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGE
    TQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEF
    GGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIV
    GAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVL
    LVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGS
    DDTVAVGIVYQF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Wang et al., 2017)
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.635
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
33. ompT
  • Gene Name : ompT
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : APO18432
  • Other Database IDs : CDD:236813
  • Taxonomy ID : 562
  • Protein Name : OmpT
  • Protein pI : 7.77
  • Protein Weight : 34939.14
  • Protein Length : 369
  • Protein Note : commensal strain
  • Protein Sequence : Show Sequence
    >APO18432.1 OmpT (plasmid) [Escherichia coli]
    MYLKILATALSAPVAFAALASDTGLSFTPEKISTEIDFGTLSGKAKERVYLPEEKGRKASQLDWKYSNAP
    IVKGAFNWDLLPRVSVGASGWTTLAGRGGNMVDRDWLDTSNPGTWTDESKHPNTRLNFANEFDLNIKGWL
    LNQPDYQLGLMAGYQENRYSFTAKGGSYIYSSEGGFRDETGSFPDGERAIGYKQHFKMPYIGLTGNYRYD
    SFEFGGSFKYSGWVKASDNDEHYNPEKRITYRSDVNNQNYYSVSLHAGYYITPAAKVYVEGTWNRITNKK
    GDTSLYSRNLNISDHTKNGAGIESYNFMTTAGLKYYF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : recombinant antigens (rAg) vaccine combining common ExPEC surface proteins EtsC, OmpA, OmpT, and TraT showed significantly (P < 0.05) elicited IgY against specific antigens, induced immune related mRNA expression in the spleen and bursa, reduced in vitro growth of multiple APEC serotypes, and decreased bacterial loads in the heart and spleen, and gross lesion scores of the air sac, heart and liver in chickens.(Van et al., 2017)
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.836
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
34. skp
  • Gene Name : skp
  • Sequence Strain (Species/Organism) : Escherichia coli O25b:H4
  • NCBI Protein GI : ARH95964
  • Other Database IDs : CDD:182724
  • Taxonomy ID : 562
  • Protein Name : periplasmic chaperone Skp
  • Protein pI : 10.45
  • Protein Weight : 16979.04
  • Protein Length : 222
  • Protein Note : periplasmic chaperone; Provisional
  • Protein Sequence : Show Sequence
    >ARH95964.1 periplasmic chaperone Skp [Escherichia coli]
    MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
    LQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDAN
    AVAYNSSDVKDITADVLKQVK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Kumar et al., 2015)
  • Localization(Probability): Periplasmic
    (Prob.=1)
  • Adhesin Probability: 0.577
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
35. sta
  • Gene Name : sta
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : ATD53746
  • Other Database IDs : CDD:307942
  • Taxonomy ID : 562
  • Protein Name : heat-stable enterotoxin STa
  • Protein pI : 5.02
  • Protein Weight : 8381.73
  • Protein Length : 134
  • Protein Note : Heat-stable enterotoxin ST; pfam02048
  • Protein Sequence : Show Sequence
    >ATD53746.1 heat-stable enterotoxin STa [Escherichia coli]
    MKKLMLAIFISVLSFPSFSQSTESLDSSKEKITLETKKCDVVKNNSEKKSENMNNTFYCCELCCNPACAG
    CY
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Zeinalzadeh et al., 2017)
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.674
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
36. stx1B
  • Gene Name : stx1B
  • Sequence Strain (Species/Organism) : Escherichia coli O157
  • NCBI Protein GI : OWR88953
  • Other Database IDs : CDD:280428
    GOA:Q8X4M7
    HSSP: P69178
    InterPro: IPR003189
    InterPro: IPR008992
    UniProtKB/TrEMBL: Q8X4M7
  • Taxonomy ID : 1045010
  • Gene Strand (Orientation) : ?
  • Protein Name : Shiga toxin Stx1 subunit B
  • Protein pI : 8.22
  • Protein Weight : 9793.31
  • Protein Length : 155
  • Protein Note : Derived by automated computational analysis using gene prediction method: Protein Homology.
  • Protein Sequence : Show Sequence
    >OWR88953.1 Shiga toxin Stx1 subunit B [Escherichia coli O157]
    MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTV
    TIKTNACHNGGGFSEVIFR
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : In agreement with the data for serum IgG anti toxin immunogenicity, it appears that the construct producing the secreted form of the Stx1B EspP fusion was the most protective against challenge with a virulent Stx1 toxin producing rEPEC strain of a different serogroup. (Byrd et al., 2017)

    Vaccination against both PNAG and Stx, using a construct such as the 9GlcNH2-Stx1b conjugate vaccine, would be protective (Lu et al., 2014).
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.675
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
37. stx2eB
  • Gene Name : stx2eB
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : AAQ63639
  • Other Database IDs : CDD:280428
  • Taxonomy ID : 562
  • Protein Name : Shiga toxin 2e subunit B
  • Protein pI : 9.27
  • Protein Weight : 9441.99
  • Protein Length : 146
  • Protein Note : Shiga-like toxin beta subunit; pfam02258
  • Protein Sequence : Show Sequence
    >AAQ63639.1 Shiga toxin 2e subunit B [Escherichia coli]
    MKKMFIAVLFALVSVNAMAADCAKGKIEFSKYNEDNTFTVKVSGREYWTNRWNLQPLLQSAQLTGMTVTI
    ISNTCSSGSGFAQVKFN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Won and John, 2017)
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.599
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
38. StxB2
  • Gene Name : StxB2
  • Sequence Strain (Species/Organism) : Enterobacteria phage 933W
  • VO ID : VO_0010938
  • NCBI Gene ID : 1262010
  • NCBI Protein GI : 9632507
  • Locus Tag : ST933Wp41
  • Genbank Accession : AF125520
  • Protein Accession : NP_049501
  • Taxonomy ID : 10730
  • Gene Starting Position : 22432
  • Gene Ending Position : 22701
  • Gene Strand (Orientation) : +
  • Protein Name : Shiga toxin 2 subunit B
  • Protein pI : 4.98
  • Protein Weight : 9278.79
  • Protein Length : 89
  • DNA Sequence : Show Sequence
    >NC_000924.1:22432-22701 Enterobacteria phage 933W, complete genome
    CATGAAGAAGATGTTTATGGCGGTTTTATTTGCATTAGCTTCTGTTAATGCAATGGCGGCGGATTGTGCT
    AAAGGTAAAATTGAGTTTTCCAAGTATAATGAGGATGACACATTTACAGTGAAGGTTGACGGGAAAGAAT
    ACTGGACCAGTCGCTGGAATCTGCAACCGTTACTGCAAAGTGCTCAGTTGACAGGAATGACTGTCACAAT
    CAAATCCAGTACCTGTGAATCAGGCTCCGGATTTGCTGAAGTGCAGTTTAATAATGACTG
    
    
  • Protein Sequence : Show Sequence
    >NP_049501.1 Shiga toxin 2 subunit B [Enterobacteria phage 933W]
    MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTI
    KSSTCESGSGFAEVQFNND
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): rBCG -Stx2B (Escherichia coli ) , Shiga Toxin 2 B Subunit Vaccine
  • Localization(Probability): Periplasmic
    (Prob.=0.984)
  • Adhesin Probability: 0.525
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
39. Tir
  • Gene Name : Tir
  • Sequence Strain (Species/Organism) : Escherichia coli O157:H7 str. EDL933
  • VO ID : VO_0010940
  • NCBI Gene ID : 960860
  • NCBI Protein GI : 15804222
  • Locus Tag : Z5112
  • Genbank Accession : AE005174
  • Protein Accession : NP_290261
  • Taxonomy ID : 155864
  • Gene Starting Position : 4668912
  • Gene Ending Position : 4670588
  • Gene Strand (Orientation) : -
  • Protein Name : translocated intimin receptor protein
  • Protein pI : 4.78
  • Protein Weight : 54549.01
  • Protein Length : 558
  • DNA Sequence : Show Sequence
    >NC_002655.2:4668912-4670588 Escherichia coli O157:H7 str. EDL933 genome
    TTTAGACGAAACGATGGGATCCCGGCGCTGGTGGGTTATTCGAAGTATTCACAGCGCTATTACTCCCCCC
    CGTTAATCCTCCCATGTCATGGCGTAATCCACCACTTAGCGCCAGACGCGCATAAGTGCTTTGAATCCCC
    GCACTTGGATTTCCTAATAACCGTGCGCCGTTATCAGTAGTATCCCGGGGAGGATGTTGAATGGTGCTAT
    ATACAACAGAATCTGTATTCCCCATATTCTGAACAGACGTATTAGAATTAGAAGTCGGCACCTGCGAATC
    ATGCAGCGATGTTTTAACATCAGCATACGGATTCTGCACGGTCCCTATGCTGGAAGTGTCAAAGAAAGTC
    GACGAGGTGCTAGCCATCGAGCTACGTCTGCTCTCCATGGTATCTTCTGACCCAGGGGTATCTACATTGC
    CCTGTGCAGGTGTATTATTTGCAGGCTTATTCTCTACCGTACGTGCGCTTGTAGTTGTAGTTGTAGTAGT
    TGTTGTTGTTGTTTGTTCTACCGGCTGATTTTTTCGATGAAGCGCAGCGGTGACGGCAACACCAATTCCC
    CCACCAAGAATCAATGCGCCACTAAGACCGTAGCCAGCCCCCGATGAAACTTTCAGCTCCTCCTGGCGTT
    TAGCTTGTTGTTCATCATATTTTTTTTGCGCCTGAGCATTATTTTCAATGGCTTGCTGTTTGGCCTCTTC
    GCCTGCTGCTTTAGCCTGCTCTTCTATATTCGCAACAACATCATCTTTCAATACCCCTGACGGAATCGCA
    TTTCCGAGCTCATCGATATTAACTTTTTGATTATCTGGGTTCTGGAACGCTTCTTTCGTTAACTGATCTC
    TTGTCGCAGTTTCAGTTGCACTTGCAGCTGCATCAGGGTCGGTCGTGGTTGGGCTATCCGGCTCCGGCGT
    CAATGCAAGCGCCTGTACAATACCCGTCGCCGCCAACCCTATCAGACCTGTAGCAACAGTCCCCAACGCC
    AACCAAAGTTTAGGATCTGAACGAAGGCTGGAAGTTGAGGTTGAGGTCTGAGTTTCTGTGGTGTTTTCCG
    CACCGCTATTTGACTCCCTCAACTCCCCAACGCCTTTTGACTCCCCAGCACCTTTGGACTCCCCGGTCCC
    TTTGGGCTCTAACAGCTCCAGTATCCTTTGGCGGGCTTCCGTGATATCTGAAGCAACGGTGACCATAGCA
    TGCCCAGCACCACCACGGCCTCCAGTAAATACAAATTTGTCTTTACCTTCAGGATCAATGGACTGCAAGC
    GAGCGTACTCTTGATCACTTAAAACAACAGAGGTCTCAACACCATTCCTCTGACCGACAGCAATATGTTT
    ACCATCTTCCTGAGTTTCAACTCGAAATACCGAAGAGCCAATCTGCCTGTTAAGAGTATCGAGCGGACCA
    TGATCATGAAGAACTTCAAATCCATCATTCAGTGTTATCTCAGACGCCGCCAGGCGCATCGGATTTACAG
    GAAGTCCAGGAACATCACTGGCACGATTGTCGCCAGAATCAGCCATAGAATTCCTTACAGGCGTAAATAG
    CGCACGAGATCCCAACGGCCCCGTAGAGTTAATGAGCTGACCACGCCCCCCTGCACCGTCGGTTTGTGAA
    GGTAATGGAGGTGCAGGAGGAATTGAATTATTCACATTGGGATTATGACCAAGATTACCAATAGGCA
    
    
  • Protein Sequence : Show Sequence
    >NP_290261.1 translocated intimin receptor protein [Escherichia coli O157:H7 str. EDL933]
    MPIGNLGHNPNVNNSIPPAPPLPSQTDGAGGRGQLINSTGPLGSRALFTPVRNSMADSGDNRASDVPGLP
    VNPMRLAASEITLNDGFEVLHDHGPLDTLNRQIGSSVFRVETQEDGKHIAVGQRNGVETSVVLSDQEYAR
    LQSIDPEGKDKFVFTGGRGGAGHAMVTVASDITEARQRILELLEPKGTGESKGAGESKGVGELRESNSGA
    ENTTETQTSTSTSSLRSDPKLWLALGTVATGLIGLAATGIVQALALTPEPDSPTTTDPDAAASATETATR
    DQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAK
    RQEELKVSSGAGYGLSGALILGGGIGVAVTAALHRKNQPVEQTTTTTTTTTTTSARTVENKPANNTPAQG
    NVDTPGSEDTMESRRSSMASTSSTFFDTSSIGTVQNPYADVKTSLHDSQVPTSNSNTSVQNMGNTDSVVY
    STIQHPPRDTTDNGARLLGNPSAGIQSTYARLALSGGLRHDMGGLTGGSNSAVNTSNNPPAPGSHRFV
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized intranasally with recombinant Tir protein had a survival rate of 92.9% after challenge with EHEC 0157:H7 (Fan et al., 2011).

    Immunization of calves with recombinant EHEC O157 EspA, intimin and Tir resulted in the generation of antibodies capable of cross-reacting with antigens from non-O157 EHEC serotypes, suggesting that immunization with these antigens may provide a degree of cross-protection against other EHEC serotypes (McNeilly et al., 2015)
  • Related Vaccine(s): E. coli O157:H7 intimin vaccine , E. coli O157:H7 subunit vaccine expressing Esps and Tir , Recombinant Tir Protein Vaccine
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.885
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
40. traT
  • Gene Name : traT
  • Sequence Strain (Species/Organism) : Escherichia coli
  • NCBI Protein GI : AAT94214
  • Taxonomy ID : 562
  • Protein Name : TraT
  • Protein pI : 10.11
  • Protein Weight : 22766.35
  • Protein Length : 258
  • Protein Note : similar to Escherichia coli plasmid p0113 TraT encoded by GenBank Accession Number AY258503
  • Protein Sequence : Show Sequence
    >AAT94214.1 TraT (plasmid) [Escherichia coli]
    MADTCRDTVVLLEKNLTRVMRLKKRPVPENADEKKKHTRTLQDAERSLAQARLSARRLALRHVEKSQIVT
    TDALSENESDLLQPEGPPFHLCAFCHAWHCLNGYAAAQGVMVWLPDLHPASVVALNARALQEIFSDNRQR
    VRQGRAVLNALVQNRLAVEEKFRTWRPADFADALRRWPPAQRKTLREKMDGVALILLPDSFPDKKYVM
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : recombinant antigens (rAg) vaccine combining common ExPEC surface proteins EtsC, OmpA, OmpT, and TraT showed significantly (P < 0.05) elicited IgY against specific antigens, induced immune related mRNA expression in the spleen and bursa, reduced in vitro growth of multiple APEC serotypes, and decreased bacterial loads in the heart and spleen, and gross lesion scores of the air sac, heart and liver in chickens.(Van et al., 2017)
  • Localization(Probability): Unknown
    (Prob.=0.2)
  • Adhesin Probability: 0.051
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
II. References
1. Ahmed et al., 2014: Ahmed B, Loos M, Vanrompay D, Cox E. Oral immunization with Lactococcus lactis-expressing EspB induces protective immune responses against Escherichia coli O157:H7 in a murine model of colonization. Vaccine. 2014; 32(31); 3909-3916. [PubMed: 24877767].
2. Alteri et al., 2009: Alteri CJ, Hagan EC, Sivick KE, Smith SN, Mobley HL. Mucosal immunization with iron receptor antigens protects against urinary tract infection. PLoS pathogens. 2009; 5(9); e1000586. [PubMed: 19806177].
3. Asadi et al., 2016: Asadi Karam MR, Habibi M, Bouzari S. Use of flagellin and cholera toxin as adjuvants in intranasal vaccination of mice to enhance protective immune responses against uropathogenic Escherichia coli antigens. Biologicals : journal of the International Association of Biological Standardization. 2016; 44(5); 378-386. [PubMed: 27461240].
4. Byrd et al., 2017: Byrd W, Ruiz-Perez F, Setty P, Zhu C, Boedeker EC. Secretion of the Shiga toxin B subunit (Stx1B) via an autotransporter protein optimizes the protective immune response to the antigen expressed in an attenuated E. coli (rEPEC E22?ler) vaccine strain. Veterinary microbiology. 2017; 211; 180-188. [PubMed: 29102116].
5. Daley et al., 2007: Daley A, Randall R, Darsley M, Choudhry N, Thomas N, Sanderson IR, Croft N, Kelly P. Genetically modified enterotoxigenic escherichia coli vaccines induce mucosal immune responses without inflammation. Gut. 2007 Jun 12; ; . [PubMed: 17566016].
6. Durant et al., 2007: Durant L, Metais A, Soulama-Mouze C, Genevard JM, Nassif X, Escaich S. Identification of candidates for a subunit vaccine against extraintestinal pathogenic Escherichia coli. Infection and immunity. 2007 Apr; 75(4); 1916-25. [PubMed: 17145948 ].
7. Durant et al., 2007: Durant L, Metais A, Soulama-Mouze C, Genevard JM, Nassif X, Escaich S. Identification of candidates for a subunit vaccine against extraintestinal pathogenic Escherichia coli. Infection and immunity. 2007; 75(4); 1916-1925. [PubMed: 17145948].
8. Fan et al., 2011: Fan HY, Wang L, Luo J, Long BG. Protection against Escherichia coli O157:H7 challenge by immunization of mice with purified Tir proteins. Molecular biology reports. 2011; ; . [PubMed: 21567195].
9. Habibi et al., 2015: Habibi M, Asadi Karam MR, Bouzari S. Evaluation of the effect of MPL and delivery route on immunogenicity and protectivity of different formulations of FimH and MrpH from uropathogenic Escherichia coli and Proteus mirabilis in a UTI mouse model. International immunopharmacology. 2015; 28(1); 70-78. [PubMed: 26033493].
10. Hancock et al., 2008: Hancock V, Ferrières L, Klemm P. The ferric yersiniabactin uptake receptor FyuA is required for efficient biofilm formation by urinary tract infectious Escherichia coli in human urine. Microbiology (Reading, England). 2008; 154(Pt 1); 167-175. [PubMed: 18174135].
11. Harris et al., 2011: Harris JA, Roy K, Woo-Rasberry V, Hamilton DJ, Kansal R, Qadri F, Fleckenstein JM. Directed evaluation of enterotoxigenic Escherichia coli autotransporter proteins as putative vaccine candidates. PLoS neglected tropical diseases. 2011; 5(12); e1428. [PubMed: 22163060].
12. Hu et al., 2009: Hu CX, Xu ZR, Li WF, Niu D, Lu P, Fu LL. Secretory expression of K88 (F4) fimbrial adhesin FaeG by recombinant Lactococcus lactis for oral vaccination and its protective immune response in mice. Biotechnology letters. 2009; 31(7); 991-997. [PubMed: 19277476].
13. Kumar et al., 2015: Kumar A, Hays M, Lim F, Foster LJ, Zhou M, Zhu G, Miesner T, Hardwidge PR. Protective Enterotoxigenic Escherichia coli Antigens in a Murine Intranasal Challenge Model. PLoS neglected tropical diseases. 2015; 9(8); e0003924. [PubMed: 26244636].
14. Langermann et al., 1997: Langermann S, Palaszynski S, Barnhart M, Auguste G, Pinkner JS, Burlein J, Barren P, Koenig S, Leath S, Jones CH, Hultgren SJ. Prevention of mucosal Escherichia coli infection by FimH-adhesin-based systemic vaccination. Science (New York, N.Y.). 1997; 276(5312); 607-611. [PubMed: 9110982].
15. Lin et al., 2017: Lin R, Zhu B, Zhang Y, Bai Y, Zhi F, Long B, Li Y, Wu Y, Wu X, Fan H. Intranasal immunization with novel EspA-Tir-M fusion protein induces protective immunity against enterohemorrhagic Escherichia coli O157:H7 challenge in mice. Microbial pathogenesis. 2017; 105; 19-24. [PubMed: 28163157].
16. Liu et al., 2012: Liu C, Chen Z, Tan C, Liu W, Xu Z, Zhou R, Chen H. Immunogenic characterization of outer membrane porins OmpC and OmpF of porcine extraintestinal pathogenic Escherichia coli. FEMS microbiology letters. 2012; 337(2); 104-111. [PubMed: 23003111].
17. Lu et al., 2014: Lu X, Skurnik D, Pozzi C, Roux D, Cywes-Bentley C, Ritchie JM, Munera D, Gening ML, Tsvetkov YE, Nifantiev NE, Waldor MK, Pier GB. A Poly-N-acetylglucosamine-Shiga toxin broad-spectrum conjugate vaccine for Shiga toxin-producing Escherichia coli. mBio. 2014; 5(2); 00974-00914. [PubMed: 24667709].
18. Luo et al., 2016: Luo Q, Vickers TJ, Fleckenstein JM. Immunogenicity and Protective Efficacy against Enterotoxigenic Escherichia coli Colonization following Intradermal, Sublingual, or Oral Vaccination with EtpA Adhesin. Clinical and vaccine immunology : CVI. 2016; 23(7); 628-637. [PubMed: 27226279].
19. McNeilly et al., 2015: McNeilly TN, Mitchell MC, Corbishley A, Nath M, Simmonds H, McAteer SP, Mahajan A, Low JC, Smith DG, Huntley JF, Gally DL. Optimizing the Protection of Cattle against Escherichia coli O157:H7 Colonization through Immunization with Different Combinations of H7 Flagellin, Tir, Intimin-531 or EspA. PloS one. 2015; 10(5); e0128391. [PubMed: 26020530].
20. Mobley and Alteri, 2015: Mobley HL, Alteri CJ. Development of a Vaccine against Escherichia coli Urinary Tract Infections. Pathogens (Basel, Switzerland). 2015; 5(1); . [PubMed: 26729174].
21. Moravec et al., 2007: Moravec T, Schmidt MA, Herman EM, Woodford-Thomas T. Production of Escherichia coli heat labile toxin (LT) B subunit in soybean seed and analysis of its immunogenicity as an oral vaccine. Vaccine. 2007 Feb 19; 25(9); 1647-57. [PubMed: 17188785].
22. Nesta et al., 2012: Nesta B, Spraggon G, Alteri C, Moriel DG, Rosini R, Veggi D, Smith S, Bertoldi I, Pastorello I, Ferlenghi I, Fontana MR, Frankel G, Mobley HL, Rappuoli R, Pizza M, Serino L, Soriani M. FdeC, a novel broadly conserved Escherichia coli adhesin eliciting protection against urinary tract infections. mBio. 2012; 3(2); . [PubMed: 22496310].
23. Thankavel et al., 1997: Thankavel K, Madison B, Ikeda T, Malaviya R, Shah AH, Arumugam PM, Abraham SN. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody to confer protection against experimental urinary tract infection. The Journal of clinical investigation. 1997; 100(5); 1123-1136. [PubMed: 9276729].
24. van et al., 2007: van Diemen PM, Dziva F, Abu-Median A, Wallis TS, van den Bosch H, Dougan G, Chanter N, Frankel G, Stevens MP. Subunit vaccines based on intimin and Efa-1 polypeptides induce humoral immunity in cattle but do not protect against intestinal colonisation by enterohaemorrhagic Escherichia coli O157:H7 or O26:H-. Veterinary immunology and immunopathology. 2007 Mar 15; 116(1-2); 47-58. [PubMed: 17258324].
25. Van et al., 2017: Van Goor A, Stromberg ZR, Mellata M. A recombinant multi-antigen vaccine with broad protection potential against avian pathogenic Escherichia coli. PloS one. 2017; 12(8); e0183929. [PubMed: 28837660].
26. Wang et al., 2017: Wang X, Teng D, Guan Q, Mao R, Hao Y, Wang X, Yao J, Wang J. Escherichia coli outer membrane protein F (OmpF): an immunogenic protein induces cross-reactive antibodies against Escherichia coli and Shigella. AMB Express. 2017; 7(1); 155. [PubMed: 28728309].
27. Won and John, 2017: Won G, John Hwa L. Potent immune responses induced by a Salmonella ghost delivery system that expresses the recombinant Stx2eB, FedF, and FedA proteins of the Escherichia coli-producing F18 and Shiga toxin in a murine model and evaluation of its protective effect as a porcine vaccine candidate. The Veterinary quarterly. 2017; 37(1); 81-90. [PubMed: 28317440].
28. Zeinalzadeh et al., 2017: Zeinalzadeh N, Salmanian AH, Goujani G, Amani J, Ahangari G, Akhavian A, Jafari M. A Chimeric protein of CFA/I, CS6 subunits and LTB/STa toxoid protects immunized mice against enterotoxigenic Escherichia coli. Microbiology and immunology. 2017; 61(7); 272-279. [PubMed: 28543534].