VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (50)
M. tuberculosis (26)
N. meningitidis (20)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Human Immunodeficiency Virus

Table of Contents
  1. Protective Antigens
    1. env
    2. env
    3. env
    4. env
    5. env
    6. env
    7. env
    8. env
    9. env
    10. env
    11. env
    12. env
    13. env
    14. env
    15. env from SIV
    16. Envelope polyprotein from HXB2
    17. gag
    18. gag
    19. gag
    20. gag
    21. Gag from HIV 1
    22. gag from HIV-1 vector pNL4-3
    23. gag from HXB2
    24. Gag protein from SIV-mnd 2
    25. gag-pol
    26. gag-pol SIV
    27. gp120
    28. gp120
    29. HIV1 ENV
    30. Nef
    31. nef
    32. pol
    33. pol
    34. rev
    35. rev from HIV 1
    36. Tat
    37. tat
    38. tat
    39. vif
    40. vpr
    41. vpu
1. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • VO ID : VO_0010937
  • NCBI Protein GI : 8218033
  • Other Database IDs : CDD:278917
    CDD:295533
    CDD:197369
    GOA:Q9IBN3
    HSSP: 1MEQ
    InterPro: IPR000328
    InterPro: IPR000777
    UniProtKB/TrEMBL: Q9IBN3
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : ENV (gp160)
  • Protein pI : 8.84
  • Protein Weight : 92355.68
  • Protein Length : 920
  • Protein Note : HIV-1 GB8 isolated into the cell line JM and the provirus clone was derived by PCR off extracted high molecular weight DNA
  • DNA Sequence : Show Sequence
    >gi|8218025:6237-8786 Human immunodeficiency virus type 1 proviral genome, isolate GB8, clone 46R
    ATGAAAGCGAAGGGGACCAGGAAGAATTATCAGCACTTGTGGAAATGGGGCATCATGCTCCTTGGGATGT
    TGATGATCTGTAGTGCTACAGAAAAATTGTGGGTCACAGTCTATTATGGGGTACCTGTGTGGAAAGAAGC
    AACCACCACTCTATTTTGTGCATCAGATGCTAAAGCATATGACACAGAAAAACATAATGTTTGGGCCACA
    CATGCCTGTGTACCCACAGACCCCAACCCACAAGAGGTAGTATTGGGAAATGTGACAGAAAATTTTAACA
    TGTGGAAAAATAACATGGTAGAACAGATGCATGAGGATATAATCAGTTTATGGGATCAAAGCCTAAAGCC
    ATGTGTAAAATTAACCCCACTCTGTGTTACTTTAAATTGCACTGATTTGAGGAATGATACTAATACCGAT
    AATAGTATAATGGAGGGAGGAGAAATGAAAAACTGCTCTTTCAATATCACCACAAGCATAAGGGATAAGA
    TGCAGAAAGAATATGCACTTTTGTATAAACTTGATATAGTATCAATAGGTAGTGATAATACTAGCTATAT
    ATTGACAAAGTGTGACGCCTCAGTCATTACACAGGCCTGTCCAAAGATATCCTTTGAGCCAATTCCCATA
    CATTTTTGTGCCCCGGCTGGTTTTGCGATTCTAAAGTGTAACAATAAGACATTCGATGGAAAAGGACCAT
    GTACAAATGTCAGCACAGTACAATGTACACATGGAATTAGGCCAGTAGTGTCAACTCAACTGCTGTTAAA
    TGGCAGTCTAGCAGAAGAAAAGGTAGTAATTAGATCTGACAATTTCATGGACAATACTAAAACCATAATA
    GTACAGCTGAAAGAAGCTGTAGAAATTAATTGTACAAGACCCAACAACAATACAAGAAAAGGTATATACA
    TAGGACCAGGGAGAAGATTTTATACAACAGGAAGAATAATAGGAGATATAAGACAAGCACATTGTAACAT
    TAGTAAAGAAAAATGGAATAATACTTTACACCAGATAGTTATAGAATTGAGGAAACAATTTAGGAATAAA
    ACAATAGTCTTTAATCAATCCTCAGGAGGGGACCCAGAAATTGTAATGCACAGTTTTAATTGTGGAGGGG
    AATTTTTCTACTGTAAGACAGCACAACTGTTTAATAGTACTTGGAATAGTACTGGAAATGGTACTATAAA
    GTCAAATACCACTGAAATTATCACACTCCCATGTAGAATAAAACAAATTGTAAACATGTGGCAGGAAGTA
    GGAAAAGCAATGTATGCCCCTCCCATCACAGGACAAATTAGATGTGCATCACATATTACAGGGCTACTAT
    TAACAAGAGATGGAGGTAGGGAGAACAATACCAACGAGACCGAGACCTTCAGACCTGGAGGAGGAGATAT
    GAGGGACAATTGGAGAAGTGAATTATATAAATATAAAGTAGTAAAAATTGAACCATTAGGAGTAGCACCC
    ACCAAGGCAAAGAGAAGAGTGGTGCAGAGAGAAAAAAGAGCAGTGGGAATGATAGGAGCTATGTTCCTTG
    GGTTCTTGGGAGCAGCAGGAAGCACTATGGGCGCAGCGTCACTGACGCTGACGGTACAGGCCAGACTATT
    ATTGTCTGGTATAGTGCAACAGCAAAATAATTTGCTGAGGGCTATTGAGGCGCAACAGCATCTGTTGCGA
    CTCACAGTCTGGGGCATCAAGCAGCTCCAGGCAAGAGTCCTGGCTGTGGAAAGATACCTAAAGGATCAAC
    AGCTCCTAGGGATTTGGGGTTGCTCTGGAAAACTCATTTGCACCACTACTGTGCCTTGGAATGTTAGTTG
    GAGTAATAAATCTCTGGATAAGATTTGGAATAACATGACCTGGATGGAGTGGGAAAGAGAAATTGACAAT
    TACACAAACACAATATACACCTTAATTGAAGAATCGCAGAACCAACAAGAAAAGAATGAACAAGAATTAT
    TGGAATTGGATAAGTGGGCAAATTTGTGGAATTGGTTTGACATAACAAACTGGCTGTGGTATATAAAAAT
    ATTCATAATGATAATAGGAGGCTTAATAGGTTTAAGAATAATTTTTGCTGTAATTTCTATAGTGAATAGA
    GTTAGGCGGGGATACTCACCATTATCATTGCAGACCCACCTCCCAACCCCAAGGGGACCCGACAGGCCCG
    AAGGAATCGAAGAAGAAGGTGGAGAGCAAGACAGAGACAGATCCATCAGATTGGTGAATGGATTCTTAGC
    GCTTTTCTGGGACGACCTGCGGAGCCTGTGCCTCTTCAGCTACCACCGATTGAGAGACTTACTCTTGATT
    GTGACGAGGATTGTGGGACTTCTGGGACGCAGGGGGTGGGAAGCCCTCAAGTATTGGTGGAATCTCCTGC
    AGTATTGGATCCAGGAACTAAAGAATAGTGCTATTAGCTTGCTTAATACCACAGCTATAGCAGTAGCTGA
    GGGGACAGATAGGGTTATAGAAGTAGTACAAAGAGCTTATAGAGCTATTCTCCACATACCTACAAGAATA
    AGACAGGGCTTAGAAAGGGCTTTGCAATAA
  • Protein Sequence : Show Sequence
    >CAB92793.1 ENV (gp160) [Human immunodeficiency virus 1]
    MKAKGTRKNYQHLWKWGIMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEKHNVWAT
    HACVPTDPNPQEVVLGNVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTDLRNDTNTD
    NSIMEGGEMKNCSFNITTSIRDKMQKEYALLYKLDIVSIGSDNTSYILTKCDASVITQACPKISFEPIPI
    HFCAPAGFAILKCNNKTFDGKGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEKVVIRSDNFMDNTKTII
    VQLKEAVEINCTRPNNNTRKGIYIGPGRRFYTTGRIIGDIRQAHCNISKEKWNNTLHQIVIELRKQFRNK
    TIVFNQSSGGDPEIVMHSFNCGGEFFYCKTAQLFNSTWNSTGNGTIKSNTTEIITLPCRIKQIVNMWQEV
    GKAMYAPPITGQIRCASHITGLLLTRDGGRENNTNETETFRPGGGDMRDNWRSELYKYKVVKIEPLGVAP
    TKAKRRVVQREKRAVGMIGAMFLGFLGAAGSTMGAASLTLTVQARLLLSGIVQQQNNLLRAIEAQQHLLR
    LTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTTTVPWNVSWSNKSLDKIWNNMTWMEWEREIDN
    YTNTIYTLIEESQNQQEKNEQELLELDKWANLWNWFDITNWLWYIKIFIMIIGGLIGLRIIFAVISIVNR
    VRRGYSPLSLQTHLPTPRGPDRPEGIEEEGGEQDRDRSIRLVNGFLALFWDDLRSLCLFSYHRLRDLLLI
    VTRIVGLLGRRGWEALKYWWNLLQYWIQELKNSAISLLNTTAIAVAEGTDRVIEVVQRAYRAILHIPTRI
    RQGLERALQ
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): DNA vaccine expressing multiple HIV epitopes , HIV priming with DNA vaccine expressing HIV gp160 protein and boosted with Ad5/35 vector expressing the same protein
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.128
  • Trans-membrane helices: 4
  • Detailed Vaxign Results Vaxign Results
2. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Gene ID : 155971
  • NCBI Protein GI : 9629363
  • Locus Tag : HIV1gp8
  • Genbank Accession : AF033819
  • Protein Accession : NP_057856
  • Taxonomy ID : 11676
  • Gene Starting Position : 5770
  • Gene Ending Position : 8340
  • Gene Strand (Orientation) : +
  • Protein Name : Envelope surface glycoprotein gp160, precursor
  • Protein pI : 9.19
  • Protein Weight : 91753.45
  • Protein Length : 856
  • DNA Sequence : Show Sequence
    >NC_001802.1:5770-8340 Human immunodeficiency virus 1, complete genome
    AATGAGAGTGAAGGAGAAATATCAGCACTTGTGGAGATGGGGGTGGAGATGGGGCACCATGCTCCTTGGG
    ATGTTGATGATCTGTAGTGCTACAGAAAAATTGTGGGTCACAGTCTATTATGGGGTACCTGTGTGGAAGG
    AAGCAACCACCACTCTATTTTGTGCATCAGATGCTAAAGCATATGATACAGAGGTACATAATGTTTGGGC
    CACACATGCCTGTGTACCCACAGACCCCAACCCACAAGAAGTAGTATTGGTAAATGTGACAGAAAATTTT
    AACATGTGGAAAAATGACATGGTAGAACAGATGCATGAGGATATAATCAGTTTATGGGATCAAAGCCTAA
    AGCCATGTGTAAAATTAACCCCACTCTGTGTTAGTTTAAAGTGCACTGATTTGAAGAATGATACTAATAC
    CAATAGTAGTAGCGGGAGAATGATAATGGAGAAAGGAGAGATAAAAAACTGCTCTTTCAATATCAGCACA
    AGCATAAGAGGTAAGGTGCAGAAAGAATATGCATTTTTTTATAAACTTGATATAATACCAATAGATAATG
    ATACTACCAGCTATAAGTTGACAAGTTGTAACACCTCAGTCATTACACAGGCCTGTCCAAAGGTATCCTT
    TGAGCCAATTCCCATACATTATTGTGCCCCGGCTGGTTTTGCGATTCTAAAATGTAATAATAAGACGTTC
    AATGGAACAGGACCATGTACAAATGTCAGCACAGTACAATGTACACATGGAATTAGGCCAGTAGTATCAA
    CTCAACTGCTGTTAAATGGCAGTCTAGCAGAAGAAGAGGTAGTAATTAGATCTGTCAATTTCACGGACAA
    TGCTAAAACCATAATAGTACAGCTGAACACATCTGTAGAAATTAATTGTACAAGACCCAACAACAATACA
    AGAAAAAGAATCCGTATCCAGAGAGGACCAGGGAGAGCATTTGTTACAATAGGAAAAATAGGAAATATGA
    GACAAGCACATTGTAACATTAGTAGAGCAAAATGGAATAACACTTTAAAACAGATAGCTAGCAAATTAAG
    AGAACAATTTGGAAATAATAAAACAATAATCTTTAAGCAATCCTCAGGAGGGGACCCAGAAATTGTAACG
    CACAGTTTTAATTGTGGAGGGGAATTTTTCTACTGTAATTCAACACAACTGTTTAATAGTACTTGGTTTA
    ATAGTACTTGGAGTACTGAAGGGTCAAATAACACTGAAGGAAGTGACACAATCACCCTCCCATGCAGAAT
    AAAACAAATTATAAACATGTGGCAGAAAGTAGGAAAAGCAATGTATGCCCCTCCCATCAGTGGACAAATT
    AGATGTTCATCAAATATTACAGGGCTGCTATTAACAAGAGATGGTGGTAATAGCAACAATGAGTCCGAGA
    TCTTCAGACCTGGAGGAGGAGATATGAGGGACAATTGGAGAAGTGAATTATATAAATATAAAGTAGTAAA
    AATTGAACCATTAGGAGTAGCACCCACCAAGGCAAAGAGAAGAGTGGTGCAGAGAGAAAAAAGAGCAGTG
    GGAATAGGAGCTTTGTTCCTTGGGTTCTTGGGAGCAGCAGGAAGCACTATGGGCGCAGCCTCAATGACGC
    TGACGGTACAGGCCAGACAATTATTGTCTGGTATAGTGCAGCAGCAGAACAATTTGCTGAGGGCTATTGA
    GGCGCAACAGCATCTGTTGCAACTCACAGTCTGGGGCATCAAGCAGCTCCAGGCAAGAATCCTGGCTGTG
    GAAAGATACCTAAAGGATCAACAGCTCCTGGGGATTTGGGGTTGCTCTGGAAAACTCATTTGCACCACTG
    CTGTGCCTTGGAATGCTAGTTGGAGTAATAAATCTCTGGAACAGATTTGGAATCACACGACCTGGATGGA
    GTGGGACAGAGAAATTAACAATTACACAAGCTTAATACACTCCTTAATTGAAGAATCGCAAAACCAGCAA
    GAAAAGAATGAACAAGAATTATTGGAATTAGATAAATGGGCAAGTTTGTGGAATTGGTTTAACATAACAA
    ATTGGCTGTGGTATATAAAATTATTCATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGC
    TGTACTTTCTATAGTGAATAGAGTTAGGCAGGGATATTCACCATTATCGTTTCAGACCCACCTCCCAACC
    CCGAGGGGACCCGACAGGCCCGAAGGAATAGAAGAAGAAGGTGGAGAGAGAGACAGAGACAGATCCATTC
    GATTAGTGAACGGATCCTTGGCACTTATCTGGGACGATCTGCGGAGCCTGTGCCTCTTCAGCTACCACCG
    CTTGAGAGACTTACTCTTGATTGTAACGAGGATTGTGGAACTTCTGGGACGCAGGGGGTGGGAAGCCCTC
    AAATATTGGTGGAATCTCCTACAGTATTGGAGTCAGGAACTAAAGAATAGTGCTGTTAGCTTGCTCAATG
    CCACAGCCATAGCAGTAGCTGAGGGGACAGATAGGGTTATAGAAGTAGTACAAGGAGCTTGTAGAGCTAT
    TCGCCACATACCTAGAAGAATAAGACAGGGCTTGGAAAGGATTTTGCTATA
    
    
  • Protein Sequence : Show Sequence
    >NP_057856.1 Envelope surface glycoprotein gp160, precursor [Human immunodeficiency virus 1]
    MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWA
    THACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNT
    NSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSF
    EPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDN
    AKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLR
    EQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRI
    KQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVK
    IEPLGVAPTKAKRRVVQREKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIE
    AQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWME
    WDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFA
    VLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHR
    LRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAI
    RHIPRRIRQGLERILL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): ALVAC-HIV-2- env/gag/pol , HIV DNA vaccine Ad26/Ad5HVR48 encoding HIV or SIV env or gag , HIV DNA vaccine pHIS-SHIV-B , HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6) , HIV priming with DNA vaccine expressing HIV gp160 protein and boosted with Ad5/35 vector expressing the same protein , HIV recombinant vector vaccine MVA.HIVA encoding env and rev , NYVAC-HIV-2
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.125
  • Trans-membrane helices: 3
  • Detailed Vaxign Results Vaxign Results
3. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 169641099
  • Other Database IDs : CDD:278917
    CDD:295533
    CDD:197369
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein pI : 8.37
  • Protein Weight : 86073.29
  • Protein Length : 888
  • Protein Note : subtype: C
  • Protein Sequence : Show Sequence
    >ACA61283.1 envelope glycoprotein, partial [Human immunodeficiency virus 1]
    VPVWKEAKTTLFCASDAKAYETEVHNVWATHACVPTDPNPQEMLMGNVTKNFNMWKNDMVEQMHEDVISL
    WDQSLKPCVKLTPLCVTLECREVNSTNRNVTVDAKEEIKNCSFNATTEIRDKQKKVHALFYKLDIVPLDN
    KTSSNHTNYRLINCNTSAITQACPKINFDPIPIHYCAPAGFAILKCNNDTFNGTGPCTNVSTVQCTHGIK
    PVVSTQLLLNGSLAEKEIIIRSANLTDNAKTIIVHLNQSVEIVCTRPNNNTRDSIRIGPGQTFYATGDII
    GDIRQAHCNISEAAWNKTLYEVSKKLEEHYNKTIKFNASSGGDLEITTHSFNCRGEFFYCNTSKLFNGTY
    MNMNGTNSSSDSIITIPCRIKQFINMWQEVGRAMYAPPIAGNITCKSNITGLLLVRDGGPGNGTNNTETF
    RPGGGDMRDNWRSELYKYKVVEIKPLGVAPTEAKRRVVERQKRAVGLGAMFLGFLGAAGSTMGAASMTLT
    VQARQLLSGIVQQQSNLLRAIEAQQHLLQLTVWGIKQLQARVLAIERYLREQQLLGLWGCSEKLICPTTV
    PWNDSWSNKSLDIIWGNMTWMEWDKEISNYTQTIFNLLEDSQIQQEKNEKDLLELDSWKNLWNWFNISNW
    LWYIKIFIMIVGGLIGLRIIFAVLSVVNRVRQGYSPLSFQTLTPHPREPDRLRGIEEEGGEQDKGRSIRL
    VNGFLALAWDDLRSLCLFLYHRLRDFISVTARAVDILGRRGWEALKYLKSIVQYWLLELKKSAISLLDTI
    AIAVAEGTDRIIELIQRVFRAIINRPTRI
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.105
  • Trans-membrane helices: 2
  • Detailed Vaxign Results Vaxign Results
4. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1 MN
  • NCBI Protein GI : 3342812
  • Other Database IDs : CDD:278917
    CDD:295533
    CDD:197369
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein pI : 8.75
  • Protein Weight : 92117.65
  • Protein Length : 938
  • Protein Note : MN neutralization phenotype variant clone
  • Protein Sequence : Show Sequence
    >AAC31819.1 envelope glycoprotein [Human immunodeficiency virus 1]
    MRVKGIRRNYQHWWGWGTMLLGLLMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEAHNVWAT
    HACVPTDPNPQEVELVNVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTDLRNTTNTN
    NSTDNNNSNSEGTIKGGEMKNCSFNITTSIGDKVQKEYALLYKLDIESIDNDSTSYRLISCNTSVITQAC
    PKISFEPIPIHYCAPAGFAILKCNDKKFSGKGSCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSE
    DFTDNAKTIIVHLKESVQINCTRPNYNKRKRIHIGPGRAFYTTKNIKGTIRQAHCIISRAKWNDTLRQIV
    SKLKEQFKNKTIVFNPSSGGDPEIVMHSFNCGGEFFYCNTSPLFNSTWNGNNTWNNTTGSNNNITLQCKI
    KQIINMWQKVGKAMYAPPIEGQIRCSSNITGLLLTRDGGIDTDTNDTEIFRPGGGDMRDNWRSELYKYKV
    VTIEPLGVAPTKAKRRVVQREKRAAIGALFLGFLGAAGSTMGAASVTLTVQARPLLSGIVQQQNNLLRAI
    ESQQHMLQLTVWGIKQLQARVLAVERYLKDQQLLGFWGCSGKLICTTTVPWNASWSNKSLDDIWNNMTWM
    QWEREIDNYTSLIYSLLEKSQTQQEKNEQELLELDKWASLWNWFDITNWLWYIKIFIMIVGGLVGLRIVF
    AVLSIVNRVRQGYSPLSLQTRPPVPRGPDRPEGIEEEGGERDRDTSGRLVHGFLAIIWVDLRSLFLLSYH
    HLRDLLLIAARIVELLGRRGWEVLKYWWNLLQYWSQELKSSAVSLLNAAAIAVAEGTDRVIEVLQRAGRA
    ILHIPTRIRQGLERALL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine pCMN160
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.170
  • Trans-membrane helices: 4
  • Detailed Vaxign Results Vaxign Results
5. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 58043865
  • Other Database IDs : CDD:278917
    CDD:295533
    CDD:197369
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein pI : 7.78
  • Protein Weight : 91300.9
  • Protein Length : 933
  • Protein Note : clone can be used to generate pseudotyed infectious virions that use the CCR5 coreceptor;
    subtype: B
  • Protein Sequence : Show Sequence
    >AAW64267.1 envelope glycoprotein [Human immunodeficiency virus 1]
    MRVKEIRKNYRHLWKWGIMLLGMLMICSATENLWVTVYYGVPVWKEATTTLFCASDAKGYEKEVHNVWAT
    HACVPTDPNPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCSDVNTTSVNT
    TASSMEGGEIKNCSFNTTTSMSDKMQKEYALFYTLDVVPIVKENNTYRLISCNTSVITQACPKVSFEPIP
    IHYCAPAGFAILMCNNKTFDGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVVIRSDNFTDNAKTI
    IVHLNESIEITCTRPNNNTSKSITIGPGRAFYATGRIIGDIRKAHCNISGEKWHNALEQIVKKLGEKFEN
    ATTIRFNQSSGGDQEIVMHTFNCGGEFFYCNSTQLFNSTWWPNGTTTEWSNETSNGTITLPCRIKQIINM
    WQEVGKAMYAPPISGPISCSSNITGLLLVRDGGNDNETNGTETFRPGGGDMRDNWRSELYKYKVVKIEPL
    GVAPTKAKRRVVQREKRAVGLGAMFLGFLGAAGSTMGAASITLTVQARLLLSGIVQQQNNLLRAIEAQQH
    LLQLTVWGIKQLQARVLAIERYLKDQQLLGIWGCSGKLICTTAVPWNSSWSNKSLKWIWDNMTWMEWEKE
    IDNYTGIIYNLLEESQNQQDKNEKELLELDKWASLWTWFDITNWLWYIKIFIMIVGGLVGLRIVFAVLSI
    VNRVRQGYSPLSFQTRLPAPRGLDRPEGTEEEGGDRDKDRSIRLVDGFLALIWDDLRSLCLFSYHRLRDL
    LLIVARVVEILGHRGWEILKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRIIEVLQRIGRAILHIP
    TRIRQGLERALL
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.156
  • Trans-membrane helices: 2
  • Detailed Vaxign Results Vaxign Results
6. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 1129018
  • Other Database IDs : CDD:278917
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein gp120
  • Protein pI : 10.41
  • Protein Weight : 10151.67
  • Protein Length : 175
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >AAC37905.1 envelope glycoprotein gp120, partial [Human immunodeficiency virus 1]
    VVIRSENFTNNAKTIIVHLNKSVEIDCIRPNNNTRRSIHIGPGRAFYGTDIIGDIRQAHCNISRKEWNDT
    LTKIVSKLKEQFKNKTIVFN
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.186
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
7. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus strain SHIV89.6P
  • NCBI Protein GI : 72398919
  • Other Database IDs : CDD:278917
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope protein
  • Protein pI : 9.92
  • Protein Weight : 40473.44
  • Protein Length : 461
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >AAZ72871.1 envelope protein, partial [Simian-Human immunodeficiency virus]
    LNCTNLNITKNTTNPTSSSWGMMEEGEIKNCSFYITTSIRDKVKKEYALFNRLDVVPVENTSYRLISCNT
    SVITQACPKVSFQPIPIHYCVPAGFAILKCNNKTFNGSGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEE
    DIVIRSENFTNNVKNIIVQLNESVVINCTRPNNNTRERLSIGPGRAFYARRNIIGDIRQAHCNISRAKWN
    NTLQQIVIKLREKYRNKTIAFNQSSGGDPEIVMHSFNCGGEFFYCNTAQLFNSTWNVTGGTNGTKGSDII
    TLQCRIKQIINMWQKVGKAMYAPPIKGQIRCSSNITGLLLTRDGGSSTETEPEIFRPGGGDMRDNWRSEL
    YKYKVVRIEPIGVAPTRAKRRTVQREKR
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): DNA and poxvirus priming-boosting SHIV vaccine , HIV DNA vaccine SIVmac239 Gag-Pol-Nef and mock Env with rAd5 boost
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.316
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
8. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus strain SHIV-89.6
  • NCBI Protein GI : 2828045
  • Other Database IDs : CDD:278917
    CDD:295533
    CDD:197369
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : env
  • Protein pI : 9.04
  • Protein Weight : 91775.38
  • Protein Length : 922
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >AAB99966.1 env [Simian-Human immunodeficiency virus]
    MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWREATTTLFCASDAKAYDTEVHNVWA
    THACVPTDPNPQEVVLGNVTENFNMWKNNMVDQMHEDIISLWDESLKPCVKLTPLCVTLNCTNLNITKNT
    TNPTSSSWGMMEKGEIKNCSFYITTSIRNKVKKEYALFNRLDVVPIENTNNTKYRLISCNTSVITQACPK
    VSFQPIPIHYCVPAGFAMLKCNNKTFNGSGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEDIVIRSENF
    TDNAKTIIVQLNESVVINCTRPNNNTRRRLSIGPGRAFYARRNIIGDIRQAHCNISRAKWNNTLQQIVIK
    LREKFRNKTIAFNQSSGGDPEIVMHSFNCGGEFFYCNTAQLFNSTWNVTGGTNGTEGNDIITLQCRIKQI
    INMWQKVGKAMYAPPITGQIRCSSNITGLLLTRDGGNSTETETEIFRPGGGDMRDNWRSELYKYKVVRIE
    PIGVAPTRAKRRTVQREKRAVGIGAVFLGFLGAAGSTMGAASVTLTVQARLLLSGIVQQQNNLLRAIEAQ
    QHMLQLTVWGIKQLQARVLALERYLRDQQLMGIWGCSGKLICTTSVPWNVSWSNKSVDDIWNNMTWMEWE
    REIDNYTDYIYDLLEKSQTQQEKNEKELLELDKWASLWNWFDITNWLWYIRLFIMIVGGLIGLRIVFAVL
    SIVNRVRQGYSPLSFQTLLPASRGPDRPEGTEEEGGERDRDRSGPLVNGSLALIWDDLRSLCLFSYHRLR
    DLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAIRH
    IPRRIRQGLERILL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.092
  • Trans-membrane helices: 3
  • Detailed Vaxign Results Vaxign Results
9. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 2
  • NCBI Protein GI : 1845209
  • Other Database IDs : CDD:278917
    CDD:278918
    CDD:197369
  • Taxonomy ID : 11709
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope polyprotein
  • Protein pI : 8.65
  • Protein Weight : 93936.04
  • Protein Length : 945
  • Protein Note : similar to HIV2BEN, GenBank Accession Number M30502, and to HIV2D194, GenBank Accession Number J04542
  • Protein Sequence : Show Sequence
    >AAB47784.1 envelope polyprotein [Human immunodeficiency virus 2]
    MEPGRNQLLAVILLTSACLIYCKQYVTVFYGVPVWRNASIPLFCATKNRDTWGTIQCLPDNDDYQEIPLN
    VTEAFDAWDNTVTEQAIEDVWRLFETSIKPCVKLTPLCVAMNCNPVTGNNTNATAKPTAARPTTNPSYLT
    IINESSTCVGADNCTGLGDEGMVNCKFNMTGLEQDKIKGYTDTWYSDDVVCDSTNKTGTNTTCYMRHCNT
    SVIKESCDKHYWDSMKFRYCTPPGYALLRCNDTNYSGFAPNCPKVVAASCTRMMETQTSTWFGFNGTRAE
    NRTYIYWHGRDNRTIISLNKHYNLTMHCKRPGNKTVVPITLMSGHRFHSQAVINKKPRQAWCWFKGNWKG
    AMQEVKQTLAGHPRYKGTNDTSKINFVKPGVGSDPEVTYMWTNCRGEFFYCNMTWFLNWVENRTSQKQRN
    YAPCHIRQIINTWHKVGQYVYLPPREGELTCNSTVTSIIANIDTDGNQTNITFSAEVAELYRLELGDYKL
    IEITPIGFAPTSEKRYSSAPARNKRGVFVLGLLGFLATAGSAMGAASLTLSAQSRTLLAGIVQQQQQLLD
    IVKRQQELLRLTVWGTKNLQARVTAIEKYLKDQAQLNSWGCTFRQVCHTTVPWVNDSLTPRWNNMTWQEW
    EKQVRYLEANISQSLEEAQIQQEKNMYELQKLNSWDVFGNWFDLTSWIKYIQYGVYIVVGIIALRIAIYV
    VQLLSRFRKGYRPVFSSPPGYLQQIHIHTDRGQPANEETEGDAGDASGYDFWPWPINYIQLLIHLLTRLL
    TGLYSICRDLLSANSPTRRLISQNLTAIRDWLRLKAAYLQYGCEWIQEAFQAIARTARETLAGAWRGLCK
    AVQRIGRGILAVPRRIRQGAEIALL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): ALVAC-HIV-2 , HIV-2 DNA vaccine , NYVAC-HIV-1
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.321
  • Trans-membrane helices: 2
  • Detailed Vaxign Results Vaxign Results
10. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1 isolate 715 from Baltimore clone 6
  • NCBI Protein GI : 475647
  • Other Database IDs : CDD:278917
    CDD:295533
    CDD:197369
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein pI : 8.4
  • Protein Weight : 91460.08
  • Protein Length : 942
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >AAB04079.1 envelope glycoprotein, partial [Human immunodeficiency virus 1]
    VTGIRKNCQHWWKWGIMLLGILMICNATEKLWVTVYYGVPVWKEANTTLFCASDAKAYDTEVHNVWATHA
    CVPTDPDPQEVELENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTNLRNDTNTTRN
    ATNTTSSETMMEEGEIKNCSFNITTSIRDKVQKEFALFYKLDVVPIENDTTSYRLISCNTSVLTQACPKV
    SFEPIPIHFCAPAGFAILKCKDKKFNGTGPCTNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVVIRSANLS
    DNAKTIIVQLNESVQMNCTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHCNLSRTKWNETLKRIVIKL
    REQYENKTIVFNQSSGGDPEIVMLSFNCGGEFFYCNSTKLFNSTWNGTESNNTGDDPIVLPCRIKQVINM
    WQEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGNSNETNTTEIFRPGGGNMKDNWRSELYKYKVVRIEPL
    GIAPTRAKRRVVQREKRAAGLGVMFLGFLGAAGSTMGAASIALTVQARQLLSGIVQQQNNLLRAIEAQQH
    MLQLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICTTTVPWNASWSNKSHDQIWQNMTWMQWEKE
    IDNYTSLIYNLIEVSQNQQEKNEQELLELDKWASLWNWFDITNWLWYIKIFIMIVGGLIGLRIVFIVLSI
    VNRVRQGYSPLSFQTHLPARRGPDRPEGIEEEGGERDRDRSGQLVTGFLAIIWVDLRSLCLFSYHRLRDL
    LLIVARIVELLGRRGWEILKYWWNLLQYWSQELKSGAVSLLNATAIAVAEGTDRVIEVLQRAGRAILHIP
    RRIRQGFERALL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): SHIV DNA vaccine encoding env and gag , SHIV(Ba-L) DNA vaccine encoding env and gag
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.102
  • Trans-membrane helices: 2
  • Detailed Vaxign Results Vaxign Results
11. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1 strain Ba-L subtype B
  • NCBI Nucleotide GI : 326367
  • NCBI Protein GI : 326371
  • Other Database IDs : CDD:278917
    CDD:295533
    CDD:197369
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein pI : 8.87
  • Protein Weight : 91185.73
  • Protein Length : 918
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >AAA44191.1 env [Human immunodeficiency virus 1]
    MRVTEIRKSYQHWWRWGIMLLGILMICNAEEKLWVTVYYGVPVWKEATTTLFCASDRKAYDTEVHNVWAT
    HACVPTDPNPQEVELKNVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTDLRNATNGN
    DTNTTSSSRGMVGGGEMKNCSFNITTNIRGKVQKEYALFYKLDIAPIDNNSNNRYRLISCNTSVITQACP
    KVSFEPIPIHYCAPAGFAILKCKDKKFNGKGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSAN
    FADNAKVIIVQLNESVEINCTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHCNLSRAKWNDTLNKIVI
    KLREQFGNKTIVFKHSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWNVTEESNNTVENNTITLPCRIKQ
    IINMWQEVGRAMYAPPIRGQIRCSSNITGLLLTRDGGPEDNKTEVFRPGGGDMRDNWRSELYKYKVVKIE
    PLGVAPTKAKRRVVQREKRAVGIGAVFLGFLGAAGSTMGAAAMTLTVQARLLLSGIVQQQNNLLRAIEAQ
    QHLLQLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICTTAVPWNASWSNKSLNKIWDNMTWIEWD
    REINNYTSIIYSLIEESQNQQEKNEQELLELDKWASLWNWFDITKWLWYIKIFIMIVGGLIGLRIVFSVL
    SIVNRVRQGYSPLSFQTHLPSSRGPDRPGGIEEEGGERDRDRSGPLVNGFLALIWVDLRSLFLFSYHRLR
    DLLLIVMRIVELLGLAGGWEVLKYWWNLLQYWSQELKNSAVSLLNATAVAVAEGTDRVIEVLQRAVRAIL
    HIPRRIRQGLERALL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): SHIV DNA vaccine encoding env and gag , SHIV(Ba-L) DNA vaccine encoding env and gag
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.155
  • Trans-membrane helices: 2
  • Detailed Vaxign Results Vaxign Results
12. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1 strain 96ZM651
  • NCBI Protein GI : 13569225
  • Other Database IDs : CDD:278917
    CDD:197369
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein pI : 8.71
  • Protein Weight : 93508.85
  • Protein Length : 949
  • Protein Note : isolated in 1996
  • Protein Sequence : Show Sequence
    >AAK30970.1 envelope glycoprotein [Human immunodeficiency virus 1]
    MRVREILRNWQRWWTWGILGFWMLMICNVWGNLWVTVYYGVPVWKEAKTTLFCASDAKSYEKEVHNVWAT
    HACVPTDPNPQEIVLGNVTENFNMWKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLNCTEVNVTRNVN
    NSVVNNTTNVNNSMNGDMKNCSFNITTELKDKKKNVYALFYKLDIVSLNETDDSETGNSSKYYRLINCNT
    SALTQACPKVSFDPIPIHYCAPAGYAILKCNNKTFNGTGPCHNVSTVQCTHGIKPVVSTQLLLNGSLAEE
    GIIIRSENLTNNVKTIIVHLNRSIEIVCVRPNNNTRQSIRIGPGQTFYATGDIIGDIRQAHCNISRTNWT
    KTLREVRNKLREHFPNKNITFKPSSGGDLEITTHSFNCRGEFFYCNTSGLFSINYTENNTDGTPITLPCR
    IRQIINMWQEVGRAMYAPPIEGNIACKSDITGLLLVRDGGSTNDSTNNNTEIFRPAGGDMRDNWRSELYK
    YKVVEIKPLGIAPTEAKRRVVEREKRAVGIGAVFLGFLGAAGSTMGAASITLTAQARQVLSGIVQQQSNL
    LRAIEAQQHLLQLTVWGIKQLQTRVLAIERYLKDQQLLGLWGCSGKLICTTAVPWNISWSNKSKTDIWDN
    MTWMQWDREISNYTNTIYRLLEDSQSQQEQNEKDLLALDSWNNLWNWFDITKWLWYIKIFIMIVGGLIGL
    RIIFAVLSIVNRVRQGYSPLSFQTLIPNPREPDRPGRIEEEGGEQDKERSVRLVSGFLALAWDDLRSLCL
    FSYHRLRDFILVTARAVELLRRSSLKGLQRGWEALKYLGSLVQYWGLELKKSAISLLDTIAIAVAEGTDR
    IIELIQGICRAIRNVPRRIRQGFETALL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): SHIV DNA vaccine encoding env and gag , SHIV(Ba-L) DNA vaccine encoding env and gag
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.168
  • Trans-membrane helices: 4
  • Detailed Vaxign Results Vaxign Results
13. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1 strain 976 clone 17
  • NCBI Protein GI : 475668
  • Other Database IDs : CDD:278917
    CDD:295533
    CDD:197369
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein pI : 8.59
  • Protein Weight : 92331.19
  • Protein Length : 944
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >AAB04093.1 envelope glycoprotein, partial [Human immunodeficiency virus 1]
    VKETQMNWPNLWKWGTLILGLVIICSASDNLWVTVYYGVPVWKDADTTLFCASDAKAHETEVHNVWATHA
    CVPTDPNPQEIHLENVTENFNMWKNKMVEQMQEDVISLWDQSLKPCVKLTPLCVTLTCTNATLNCTNLTN
    GNKTTNVSNIIGNLTDEVRNCSFHMTTELRDKKQKVYALFYKLDIVQINSSEYRLINCNTSVIKQACPKI
    SFDPIPIHYCTPAGYAILKCNDKNFNGTGPCKNVSSVQCTHGIKPVVSTQLLLNGSLAEEEIIISSENLT
    NNAKTIIVHLNKSVEISCTRPSTNTRTSIRIGPGQVFYRTGDITGDIRKAYCEINETKWNEALKQVAGKL
    KEHFNKTIIFQPPSGGDLEITMHHFNCRGEFFYCDTTQLFNRTWGENETREGRNITLPCKIKQIVNMWQG
    AGQAMYAPPISGIIKCVSNITGILLTRDGGANNSASETFRPGGGNIKDNWRSELYKYKVVQIEPLGIAPT
    RAKRRVVEREKRAVGIGAMIFGFLGAAGSTMGAASITLTVQARQLLSGIVQQQSNLLRAIEAQQHLLQLT
    VWGIKQLQARVLAVERYLKDQKFLGLWGCSGKIICTTAVPWNSTWSNKSYEEIWNNMTWIEWEREISNYT
    NQIYEILTESQDQQDRNEKDLLELDKWASLWNWFDITNWLWYIKIFIMIVGGLIGLRIIFAVLSIVNRVR
    QGYSPLSFQIPFHHQREPDRPERIEEGGGEQGRDRSVRLVSGFLALAWDDLRSLCLFLYHRLRDLLLIAT
    RTVEILGHSSLKGLRRGWEGLKYLGNLLIYWGQELRISAISLLNATAIAVGGWTDRIIEVAQRAWRAILR
    IPRRIRQGLERSLL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): SHIV DNA vaccine encoding env and gag , SHIV(Ba-L) DNA vaccine encoding env and gag
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.078
  • Trans-membrane helices: 3
  • Detailed Vaxign Results Vaxign Results
14. env
  • Gene Name : env
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1 isolate 037 clone 08
  • NCBI Protein GI : 487257
  • Other Database IDs : CDD:278917
    CDD:295533
    CDD:197369
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein
  • Protein pI : 8.4
  • Protein Weight : 91749
  • Protein Length : 946
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >AAB05027.1 envelope glycoprotein, partial [Human immunodeficiency virus 1]
    VMGIERNYPCWWTWGIMILGMIIICNTAENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHA
    CVPTDPNPQEIYMENVTEEFNMWKNNMVEQMHTDIISLWDQSLKPCVQLTPLCVTLDCSYNITNNITNSI
    TNSSVNMREEIKNCSFNMTTELRDKNRKVYSLFYKLDVVQINNGNNSSNLYRLINCNTSALTQACPKVTF
    EPIPIRYCAPAGYAILKCNDKEFNGTGLCKNVSTVQCTHGIRPVVSTQLLLNGSLAEGKVMIRSENITNN
    VKNIIVQLNETVTINCTRPNNNTRKSVRIGPGQTFYATGDIIGDIRQAHCNVSGSQWNRALHQVVGQLRE
    YWNTTIIFKNSSGGDLEITTHSFNCGGEFFYCNTSGLFNSNWTHNDTASMKPNDTITLPCRIKQIINMWQ
    RVGQAIYAPPIQGVIRCESNITGLILTRDGGGNINESQIFRPGGGDMRDNWRSELYKYKVVRIEPLGVAP
    TKAKRRVVEREKRAVVELGAVFIGFLGTAGSTMGAASITLTVQVRKLLSGIVQQQSNLLRAIEAQQHLLK
    LTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICTTNVPWNSSWSNKSEREIWENMTWLQWDKEISN
    YTHIIYELIEESQKQQEKNEQELLELDKWANLWNWFDISNWLWYIKIFIMIVGGLIGLRIVFAVLSVINR
    VRQGYSPLSFQTLTPNPRDPDRPGRIEGEGGEQDRGRSIRLVSGFLALAWDDLRNLCLSSYHQLRDFILI
    VARTVELLGHSSLKGLRLGWEGLKYLGNLLLYWGRELKTSAINLFDTIAIVVAGWTDRVIEVGQRLGRAI
    LNIPRRIRQGLERALL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): SHIV(Ba-L) DNA vaccine encoding env and gag
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.159
  • Trans-membrane helices: 3
  • Detailed Vaxign Results Vaxign Results
15. env from SIV
  • Gene Name : env from SIV
  • Sequence Strain (Species/Organism) : Simian immunodeficiency virus
  • NCBI Gene ID : 1490007
  • NCBI Protein GI : 9627208
  • Locus Tag : SIVgp6
  • Genbank Accession : M58410
  • Protein Accession : NP_054372
  • Taxonomy ID : 11723
  • Gene Starting Position : 6201
  • Gene Ending Position : 8765
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope protein
  • Protein pI : 8.73
  • Protein Weight : 91594.7
  • Protein Length : 854
  • DNA Sequence : Show Sequence
    >NC_001549.1:6201-8765 Simian immunodeficiency virus, complete genome
    TATGGGGAGATTGCTTATAAAAATACTAATAATAGCAATAGGGATAAGTATAGGAATAGGTAACCTGTAT
    GTGACAGTGTTTTATGGAATCCCAGTATGGAAAAATTCAACAGTTCAGGCATTTTGCATGACGCCCAATA
    CCAATATGTGGGCAACCACCAACTGCATACCAGATGATCATGATAATACAGAGGTGCCTCTAAACATTAC
    AGAAGCTTTCGAGGCTTGGGATAATCCGCTGGTAAAACAAGCAGAGAGTAATATACATCTACTCTTTGAA
    CAAACGATGAGGCCTTGTGTTAAGCTCTCCCCCATATGTATTAAAATGTCCTGTGTAGAGCTGAATGGTA
    CAGCCACGACAAAGGCCACCACTACTGCAACTACAACAATGACTACCCCCTGTCAGAATTGCAGTACAGA
    GCAGATAGAAGGAGAAATGGCAGAGGAACCAGCATCCAACTGCACTTTTGCAATTGCAGGATATCAAAGA
    GATGTAAAAAAGAATTATAGCATGACCTGGTATGATCAGGAGTTAGTCTGCAATAATAAAACAGGAAGTG
    AAAAGGGAAGTAAGGATTGTTACATGATACATTGTAATGATTCAGTGATAAAAGAAGCTTGTGATAAAAC
    ATATTGGGATACTTTAAGAGTAAGATACTGTGCACCAGCAGGGTATGCTTTGCTAAAATGTAATGATAAG
    GATTATAGAGGCTTTGCTCCAAAGTGCAAGAATGTTTCAGTAGTGCATTGTACTAGATTAATCAATACTA
    CTATAACTACAGGGATAGGATTAAATGGTAGTAGATCAGAAAATAGAACAGAGATATGGCAGAAAGGAGG
    AAATGATAATGATACAGTTATAATAAAGTTGAATAAGTTTTACAACTTGACAGTGAGATGCCGAAGACCT
    GGTAATAAAACAGTGTTGCCAGTAACAATCATGGCAGGGTTAGTATTTCACTCTCAGAAATATAATACCA
    GGTTAAAACAAGCGTGGTGCCACTTCCAAGGAGATTGGAAAGGGGCATGGAAAGAAGTCAGAGAAGAAGT
    AAAGAAAGTGAAAAATCTTACAGAAGTAAGCATAGAAAATATACATCTGAGAAGGATATGGGGAGATCCA
    GAATCAGCGAATTTTTGGTTCAATTGTCAAGGTGAATTTTTCTATTGTAAGATGGACTGGTTTATCAATT
    ATCTAAACAATCGAACAGAAGATGCAGAAGGTACTAATAGGACCTGTGACAAAGGGAAGCCAGGACCAGG
    ACCATGTGTTCAGAGAACTTATGTTGCCTGCCATATACGACAAGTAGTAAATGATTGGTACACTGTCTCT
    AAAAAGGTATATGCTCCACCAAGGGAAGGTCATTTGGAGTGTAACTCATCAGTCACGGCACTATACGTGG
    CAATAGATTATAACAACAAGTCTGGCCCAATAAATGTGACCCTAAGTCCTCAGGTACGCAGCATATGGGC
    GTACGAACTGGGAGACTATAAATTAGTAGAGATAACACCAATTGGCTTTGCTCCTACAGATGTAAGAAGA
    TATACTGGCCCCACAAGAGAAAAAAGGGTGCCATTCGTGCTAGGGTTTCTAGGCTTCTTGGGAGCTGCTG
    GAACTGCAATGGGCGCAGCGGCAACAACGCTGACAGTCCAGTCTCGGCATTTGCTTGCTGGGATATTGCA
    GCAGCAGAAGAACTTGCTGGCGGCTGTGGAACAGCAACAACAGTTGTTGAAGCTGACCATTTGGGGTGTG
    AAAAACCTCAATGCCCGCGTCACAGCTCTCGAGAAGTACCTAGAGGATCAGGCACGGCTAAATTCATGGG
    GATGTGCGTGGAAACAAGTATGTCACACCACAGTGCCATGGAAGTATAATAACACTCCTAAGTGGGACAA
    TATGACTTGGTTGGAGTGGGAGAGACAAATTAATGCCTTGGAAGGCAACATAACTCAACTATTGGAAGAA
    GCACAAAATCAGGAATCAAAGAATCTGGATCTGTACCAGAAATTGGATGATTGGTCAGGGTTCTGGTCAT
    GGTTCTCACTGTCAACTTGGTTAGGCTATGTTAAAATAGGATTTTTAGTGATAGTGATTATTCTAGGATT
    AAGATTTGCATGGGTATTATGGGGATGTATCAGAAATATTAGGCAGGGATATAATCCTCTCCCCCAGATC
    CATATCCACAGTTCAGCGGAACGGCCAGACAACGGAGGAGGGCAAGACAGAGGTGGAGAAAGCAGCAGCA
    GCAAATTGATAAGATTGCAGGAAGAGTCCTCAACACCTTCGAGGATCAACAACTGGTGGCTCAACTTCAA
    GAGCTGCAGCTTGAGAATAAGGACTTGGTGTTACAACATCTGCCTGACCCTCCTCATATTCATCAGGACA
    GCAGTGGGATACCTGCAGTATGGGCTCCAGCAACTCCAAGAGGCAGCAACAGGGCTTGCTCAAGCTCTGG
    CGAGGGCTGCGAGGGAAGCCTGGGGCAGACTGGGTGCTATTGTCCGATCCGCTTATCGGGCAGTCATCAA
    CAGTCCAAGAAGAGTGCGGCAAGGCCTTGAAAAAGTCCTGGGGTA
    
    
  • Protein Sequence : Show Sequence
    >NP_054372.1 envelope protein [Simian immunodeficiency virus]
    MGRLLIKILIIAIGISIGIGNLYVTVFYGIPVWKNSTVQAFCMTPNTNMWATTNCIPDDHDNTEVPLNIT
    EAFEAWDNPLVKQAESNIHLLFEQTMRPCVKLSPICIKMSCVELNGTATTKATTTATTTMTTPCQNCSTE
    QIEGEMAEEPASNCTFAIAGYQRDVKKNYSMTWYDQELVCNNKTGSEKGSKDCYMIHCNDSVIKEACDKT
    YWDTLRVRYCAPAGYALLKCNDKDYRGFAPKCKNVSVVHCTRLINTTITTGIGLNGSRSENRTEIWQKGG
    NDNDTVIIKLNKFYNLTVRCRRPGNKTVLPVTIMAGLVFHSQKYNTRLKQAWCHFQGDWKGAWKEVREEV
    KKVKNLTEVSIENIHLRRIWGDPESANFWFNCQGEFFYCKMDWFINYLNNRTEDAEGTNRTCDKGKPGPG
    PCVQRTYVACHIRQVVNDWYTVSKKVYAPPREGHLECNSSVTALYVAIDYNNKSGPINVTLSPQVRSIWA
    YELGDYKLVEITPIGFAPTDVRRYTGPTREKRVPFVLGFLGFLGAAGTAMGAAATTLTVQSRHLLAGILQ
    QQKNLLAAVEQQQQLLKLTIWGVKNLNARVTALEKYLEDQARLNSWGCAWKQVCHTTVPWKYNNTPKWDN
    MTWLEWERQINALEGNITQLLEEAQNQESKNLDLYQKLDDWSGFWSWFSLSTWLGYVKIGFLVIVIILGL
    RFAWVLWGCIRNIRQGYNPLPQIHIHSSAERPDNGGGQDRGGESSSSKLIRLQEESSTPSRINNWWLNFK
    SCSLRIRTWCYNICLTLLIFIRTAVGYLQYGLQQLQEAATGLAQALARAAREAWGRLGAIVRSAYRAVIN
    SPRRVRQGLEKVLG
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine Ad26/Ad5HVR48 encoding HIV or SIV env or gag , NYVAC-SIV , rMVTT-SIV-gpe
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.296
  • Trans-membrane helices: 4
  • Detailed Vaxign Results Vaxign Results
16. Envelope polyprotein from HXB2
  • Gene Name : Envelope polyprotein from HXB2
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 1906385
  • Other Database IDs : CDD:278917
    CDD:278918
    CDD:197369
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein pI : 9.19
  • Protein Weight : 92032.73
  • Protein Length : 936
  • Protein Note : HTLV-III/LAV
  • Protein Sequence : Show Sequence
    >AAB50262.1 envelope polyprotein [Human immunodeficiency virus 1]
    MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWA
    THACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNT
    NSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSF
    EPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDN
    AKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLR
    EQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRI
    KQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVK
    IEPLGVAPTKAKRRVVQREKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIE
    AQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWME
    WDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFA
    VLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHR
    LRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAI
    RHIPRRIRQGLERILL
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.125
  • Trans-membrane helices: 3
  • Detailed Vaxign Results Vaxign Results
17. gag
  • Gene Name : gag
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 5081475
  • Other Database IDs : CDD:249943
    CDD:279002
    CDD:197667
    CDD:285867
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : gag
  • Protein pI : 9.19
  • Protein Weight : 54682.29
  • Protein Length : 566
  • Protein Note : isolated from patient SC49 PBMC; infection was aquired in Sydney, Australia 1998; this patient registered low levels of viral RNA in plasma by RT-PCR (Amplicor 1.0) and low levels of P24 (gag) antigen by monoclonal ELISA despite symptomatic seroconversion; HIV RNA quantitation by an alternative method (bDNA, Chiron 3.0) on the same sample yielded a level of >500,000 copies/ml; subtyping in envelope and P17 gag by sequencing and phylogenetic analysis revealed subtype B; the entire gag gene was then sequenced to search for mutations to account for the failure of detection methods directed to this genomic area;
    subtype: B
  • Protein Sequence : Show Sequence
    >AAD39400.1 gag [Human immunodeficiency virus 1]
    MGARASVLSGGKLDKWEKIRLRPGGKKTYQLKHIVWASRELERFAVNPGLLETGGGCKQILVQLQPSLQT
    GSEELKSLYNAVATLYCVHQGIEVRDTKEALDKIEEEQNKSKKKAQQAAADTGNSSQVSQNYPIVQNLQG
    QMVHQAISPRTLNAWVKVIEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAA
    EWDRLHPAHAGPNAPGQMREPRGSDIAGTTSTLQEQIGWMTSNPPVPVGEIYKRWIILGLNKIVRMYSPV
    SILDIRQGPKEPFRDYVDRFYKTLRAEQASQDVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTAC
    QGVGGPSHKARILAEAMSQVTSPANIMMQRGNFRNQRKTIKCFNCGKEGHLARHCRAPRKKGCWKCGREG
    HQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTTPPQKQEPLPSQKQETIDKD
    LYPLASLKSLFGNDPSLQ
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.267
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
18. gag
  • Gene Name : gag
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 1537051
  • Other Database IDs : CDD:249943
    CDD:279002
    CDD:278525
    CDD:197667
    CDD:285867
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : gag
  • Protein pI : 9.26
  • Protein Weight : 54190.94
  • Protein Length : 561
  • Protein Note : gag gene protein p17 (matrix protein); pfam00540
  • Protein Sequence : Show Sequence
    >AAC55459.1 gag [Human immunodeficiency virus 1]
    MGARASVLSGGKLDAWEKIRLRPGGRKKYRLKHLVWASRELERFALNPSFLETAEGCQQIIEQLQSTLKT
    GLEELKSLFNTVATLWCVHQRIEVKDTKEALDKIEEVQNKSQRKTQQAAAGTGSSSKVSQNYPIVQNAQG
    QMAHQPLSPRTLNAWVKVVEEKGFNPEVIPMFSALSEGATPQDLNMMLNIVGGHQAAMQMLKETINEEPA
    EWDRVHPVHAGPIPPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGDIYKRWIILGLNKIVRMYSPV
    SILDIRQGPKEPFRDYVDRFYKTLRAEQATQEVKNWMTETLLVQNANPDCKSILKALGTGATLEEMMTAC
    QGVGGPSHKARVLAEAMSHAQHATIMMQRGNFKGQKRIKCFNCGREGHLARNCRAPRKQGCWKCGKEGHQ
    MKDCTERQANFLGKIWPSNKGRPGNFPQSRPEPTAPPAENWGMGEEITGEEITSLPKQEQKDKEHPPPLV
    SLKSLFGNDPLSQ
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.262
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
19. gag
  • Gene Name : gag
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus strain SHIV-89.6
  • NCBI Protein GI : 2828037
  • Other Database IDs : CDD:249943
    CDD:279002
    CDD:331526
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : gag
  • Protein pI : 9.12
  • Protein Weight : 54236.02
  • Protein Length : 573
  • Protein Note : gag gene protein p17 (matrix protein); pfam00540
  • Protein Sequence : Show Sequence
    >AAB99958.1 gag [Simian-Human immunodeficiency virus]
    MGVRNSVLSGKKADELEKIRLRPNGKKKYMLKHVVWAANELDRFGLAESLLENKEGCQKILSVLAPLVPT
    GSENLKSLYNTVCVIWCIHAEEKVKHTEEAKQIVQRHLVVETGTTETMPKTSRPTAPSSGRGGNYPVQQI
    GGNYVHLPLSPRTLNAWVKLIEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIRDIINEE
    AADWDLQHPQPAPQQGQLREPSGSDIAGTTSSVDEQIQWMYRQQNPIPVGNIYRRWIQLGLQKCVRMYNP
    TNILDVKQGPKEPFQSYVDRFYKSLRAEQTDAAVKNWMTQTLLIQNANPDCKLVLKGLGVNPTLEEMLTA
    CQGVGGPGQKARLMAEALKEALAPVPIPFAAAQQRGPRKPIKCWNCGKEGHSARQCRAPRRQGCWKCGKM
    DHVMAKCPDRQAGFLGLGPWGKKPRNFPMAQVHQGLMPTAPPEDPAVDLLKNYMQLGKQQREKQRESREK
    PYKEVTEDLLHLNSLFGGDQ
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6) , rBCG-SIVgag and rDIsSIVgag Prime-boost SHIV vaccine
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.105
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
20. gag
  • Gene Name : gag
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 2
  • NCBI Protein GI : 1845205
  • Other Database IDs : CDD:249943
    CDD:279002
    CDD:197667
  • Taxonomy ID : 11709
  • Gene Strand (Orientation) : ?
  • Protein Name : gag polyprotein
  • Protein pI : 9.25
  • Protein Weight : 55390.11
  • Protein Length : 591
  • Protein Note : similar to HIV2BEN, GenBank Accession Number M30502, and to HIV2D194, GenBank Accession Number J04542
  • Protein Sequence : Show Sequence
    >AAB47780.1 gag polyprotein [Human immunodeficiency virus 2]
    MGARNSVLRGKKADELEKIRLRPGGKKKYRLKHIVWAANELDRFRLAENLLESKEGCQKILTVLDPLVPT
    GSENLKSLFNTVCVIWCLHAEEKVKDTEEAKKLVQRHLVAETGTAEKMPNTSRPTAPPSGKGGNFPVQQA
    GGNYVHVPLSPRTLNAWVKLVEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDQQAAMQIIREIINEE
    AADWDAQHPIPGPLPAGQLRDPRGSDIAGTTSTVDEQIQWMYRQQNPVPVGNIYRRWIQIGLQKCVRMYN
    PTNVLDVKQGPKESFQSYVDRFYKSLRAEQADPAVKNWMTQTLLVQNANPDCKLVLKGLGMNPTLEEMLT
    ACQGVGGPGQKARLMAEALKEALTPPPIPFAAAQQRRTIRCWNCGKEGHSAKQCRAPRRQGCWKCGKPGH
    IMANCPDRQAGFLGMGSRGKKPRNFPVAQAPQGLIPTAPPADPAADLLEKYLQQGRKQREQRERPYKEVT
    EDLLHLEQGETPRREATEDLLHLNSLFGKDQ
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): ALVAC-HIV-2 , ALVAC-HIV-2- env/gag/pol , HIV-2 DNA vaccine
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.084
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
21. Gag from HIV 1
  • Gene Name : Gag from HIV 1
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • VO ID : VO_0011263
  • NCBI Gene ID : 155030
  • NCBI Protein GI : 9629360
  • Locus Tag : HIV1gp2
  • Genbank Accession : AF033819
  • Protein Accession : NP_057850
  • Taxonomy ID : 11676
  • Gene Starting Position : 335
  • Gene Ending Position : 1837
  • Gene Strand (Orientation) : +
  • Protein Name : Pr55(Gag)
  • Protein pI : 9.42
  • Protein Weight : 53447.94
  • Protein Length : 500
  • DNA Sequence : Show Sequence
    >NC_001802.1:335-1837 Human immunodeficiency virus 1, complete genome
    GATGGGTGCGAGAGCGTCAGTATTAAGCGGGGGAGAATTAGATCGATGGGAAAAAATTCGGTTAAGGCCA
    GGGGGAAAGAAAAAATATAAATTAAAACATATAGTATGGGCAAGCAGGGAGCTAGAACGATTCGCAGTTA
    ATCCTGGCCTGTTAGAAACATCAGAAGGCTGTAGACAAATACTGGGACAGCTACAACCATCCCTTCAGAC
    AGGATCAGAAGAACTTAGATCATTATATAATACAGTAGCAACCCTCTATTGTGTGCATCAAAGGATAGAG
    ATAAAAGACACCAAGGAAGCTTTAGACAAGATAGAGGAAGAGCAAAACAAAAGTAAGAAAAAAGCACAGC
    AAGCAGCAGCTGACACAGGACACAGCAATCAGGTCAGCCAAAATTACCCTATAGTGCAGAACATCCAGGG
    GCAAATGGTACATCAGGCCATATCACCTAGAACTTTAAATGCATGGGTAAAAGTAGTAGAAGAGAAGGCT
    TTCAGCCCAGAAGTGATACCCATGTTTTCAGCATTATCAGAAGGAGCCACCCCACAAGATTTAAACACCA
    TGCTAAACACAGTGGGGGGACATCAAGCAGCCATGCAAATGTTAAAAGAGACCATCAATGAGGAAGCTGC
    AGAATGGGATAGAGTGCATCCAGTGCATGCAGGGCCTATTGCACCAGGCCAGATGAGAGAACCAAGGGGA
    AGTGACATAGCAGGAACTACTAGTACCCTTCAGGAACAAATAGGATGGATGACAAATAATCCACCTATCC
    CAGTAGGAGAAATTTATAAAAGATGGATAATCCTGGGATTAAATAAAATAGTAAGAATGTATAGCCCTAC
    CAGCATTCTGGACATAAGACAAGGACCAAAGGAACCCTTTAGAGACTATGTAGACCGGTTCTATAAAACT
    CTAAGAGCCGAGCAAGCTTCACAGGAGGTAAAAAATTGGATGACAGAAACCTTGTTGGTCCAAAATGCGA
    ACCCAGATTGTAAGACTATTTTAAAAGCATTGGGACCAGCGGCTACACTAGAAGAAATGATGACAGCATG
    TCAGGGAGTAGGAGGACCCGGCCATAAGGCAAGAGTTTTGGCTGAAGCAATGAGCCAAGTAACAAATTCA
    GCTACCATAATGATGCAGAGAGGCAATTTTAGGAACCAAAGAAAGATTGTTAAGTGTTTCAATTGTGGCA
    AAGAAGGGCACACAGCCAGAAATTGCAGGGCCCCTAGGAAAAAGGGCTGTTGGAAATGTGGAAAGGAAGG
    ACACCAAATGAAAGATTGTACTGAGAGACAGGCTAATTTTTTAGGGAAGATCTGGCCTTCCTACAAGGGA
    AGGCCAGGGAATTTTCTTCAGAGCAGACCAGAGCCAACAGCCCCACCAGAAGAGAGCTTCAGGTCTGGGG
    TAGAGACAACAACTCCCCCTCAGAAGCAGGAGCCGATAGACAAGGAACTGTATCCTTTAACTTCCCTCAG
    GTCACTCTTTGGCAACGACCCCTCGTCACAATA
    
    
  • Protein Sequence : Show Sequence
    >NP_057850.1 Pr55(Gag) [Human immunodeficiency virus 1]
    MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQT
    GSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQG
    QMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAA
    EWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPT
    SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTAC
    QGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEG
    HQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLR
    SLFGNDPSSQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : HIV-1 DNA plasmids expressing Env, Gag and Tat, either alone or combined with the corresponding protein immunogens formulated in the MF59 adjuvant, resulted in protection against an experimental HIV-1 infection in C57Bl/6 mice (Bråve et al., 2007).
  • Related Vaccine(s): DNA vaccine expressing multiple HIV epitopes , HIV DNA vaccine Ad26/Ad5HVR48 encoding HIV or SIV env or gag , HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6) , HIV recombinant vector vaccine MVA-gag encoding gag , L. T -HIV-1 Gag
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.336
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
22. gag from HIV-1 vector pNL4-3
  • Gene Name : gag from HIV-1 vector pNL4-3
  • Sequence Strain (Species/Organism) : HIV-1 vector pNL4-3
  • NCBI Protein GI : 12831136
  • Other Database IDs : CDD:249943
    CDD:279002
    CDD:331526
    CDD:312289
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : gag polyprotein
  • Protein pI : 9.31
  • Protein Weight : 54183.8
  • Protein Length : 569
  • Protein Note : from sequence deposited in GenBank Accession Number M19921
  • Protein Sequence : Show Sequence
    >AAK08483.1 gag polyprotein (plasmid) [HIV-1 vector pNL4-3]
    MGARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQT
    GSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNYPIVQNLQG
    QMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAA
    EWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPT
    SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTAC
    QGVGGPGHKARVLAEAMSQVTNPATIMIQKGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEG
    HQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTTPSQKQEPIDKELYPLASLR
    SLFGSDPSSQ
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): SHIV DNA vaccine encoding env and gag , SHIV(Ba-L) DNA vaccine encoding env and gag
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.319
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
23. gag from HXB2
  • Gene Name : gag from HXB2
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1 HXB2
  • NCBI Protein GI : 328450
  • Other Database IDs : CDD:249943
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : gag protein
  • Protein pI : 9.72
  • Protein Weight : 14664.54
  • Protein Length : 201
  • Protein Note : gag gene protein p17 (matrix protein); pfam00540
  • Protein Sequence : Show Sequence
    >AAA44995.1 gag protein, partial [Human immunodeficiency virus 1]
    MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQT
    GSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNY
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): CVB4/p24(73(3))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.353
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
24. Gag protein from SIV-mnd 2
  • Gene Name : Gag protein from SIV-mnd 2
  • Sequence Strain (Species/Organism) : Simian immunodeficiency virus SIV-mnd 2
  • VO ID : VO_0010949
  • NCBI Gene ID : 956108
  • NCBI Protein GI : 27311167
  • Locus Tag : Siv2gp1
  • Genbank Accession : AF367411
  • Protein Accession : NP_758886
  • Taxonomy ID : 159122
  • Gene Starting Position : 736
  • Gene Ending Position : 2289
  • Gene Strand (Orientation) : +
  • Protein Name : gag protein
  • Protein pI : 8.78
  • Protein Weight : 55072.29
  • Protein Length : 517
  • DNA Sequence : Show Sequence
    >NC_004455.1:736-2289 Simian immunodeficiency virus 2 isolate SIVmnd-2, complete genome
    AATGGGCGCGAGCGCGTCAGGTCTTAGGGGAGAAAAATTGGACGAGCTGGAAAAGATTAGGTTACGGCCC
    TCCGGAAAAAAGAAATACCAGCTGAAACACATAATATGGGTAAGCAAGGAACTAGACAGATTTGGCCTTC
    ATGAAAAGCTGTTAGAAAGTAAGGAAGGATGCGAGAAAATTCTTAGCGTACTCTTTCCACTAGTTCCTAC
    AGGGTCAGAAAATTTAATCTCGCTGTACAACACCTGCTGCTGCGTATGGTGCGTACATGCGAAAGAGAAA
    GTAACAGATACAGAGGAAGCGAAAGAGAAAGTAAAACAAAAGCTCCATCTAGTGGCCGAAAAGGAAAATG
    CAGCATCAGAAAAAGAACAAAGAGCAATAGTGACACCTAGTGGCCGCTCAAAAAATTACCCAATACAGAT
    AATAAATCAGACCCCAGTCCATCAGGGAATTTCACCGCGCACGCTGAATGCGTGGGTAAAATGCATAGAA
    GAGAAGAAGTTTAGCCCAGAAATAGTGCCCATGTTCATAGCCTTGTCTGAAGGGTGCCTCCCCTATGATC
    TCAATGGCATGCTCAATGCTATTGGAGACCATCAGGGAGCGCTTCAAATAGTGAAGGATGTCATCAATGA
    GGAAGCTGCAGACTGGAACTTGAGACACCCACAAGTGGGTCCTATGCCCCAAGGTGTCTTGAGAAACCCA
    ACGGGCAGTGATATTGCTGGAACAACAAGCTCCATAGAAGAGCAGATAGAATGGACTACAAGGGAGCAAG
    ATGCAGTAAATGTGGGAGGAATATATAAACAATGGATAGTTTTAGGGCTTCAGAAGTGTGTAAGCATGTA
    TAATCCAGTAAACATCCTGGACATAAAGCAAGGACCAAAGGAGCCGTTCAAGGACTATGTGGACAGGTTT
    TACAAAGCTCTGCGGGCGGAGCGGACTGATCCACAAGTCAAAACCTGGATGACACAAACTTTGCTCATCC
    AGAATGCTAACCCAGATTGTAAATCCATCCTTAAAGGGCTAGGCATGAATCCCTCTTTAGAAGAGATGCC
    GCTAGCCTGCCAAGGGGTAGGAGGCCCTAAATATAAAGCACAAATGATGGCAGAGGCTATGAAGGAAGCC
    CAGTCAGCTGTAATGATGCAGAATTCGGGAGGGCCACCGCGGGGCCCCCCGAGACAACCTCCTAGAAACA
    TCAGATGCCCTAACTGTGGAAAATTTGGTCATGGGCTGAGGGACTGTATAAGCCCTCGAAAAAAGGGATG
    CTTCAAGTGTGGAGATCTAGGACACATAATGAGAAATTGCCCAAAGATGGTGAATTTTTTAGGGAATACC
    CCCTGGGGCAGTGGCAAACCCAGGAACTTCCCGGCGATGCCATTGACCCCAACGGCCCCTCCAATGCCAG
    GGATGGAAGACCCAGCAGAGAGAATGCTGTTAGATTACATGAAGAAAGGGCAACAGCAGAAAGCGGAAAG
    CAAACAGGAAAAGAAAGAGAGGGGTCCATACGAGGCAGCTTACAACTCCCTCAGTTCTCTCTTTGGAACA
    GACCAACTACAGTA
    
    
  • Protein Sequence : Show Sequence
    >NP_758886.1 gag protein [Simian immunodeficiency virus SIV-mnd 2]
    MGASASGLRGEKLDELEKIRLRPSGKKKYQLKHIIWVSKELDRFGLHEKLLESKEGCEKILSVLFPLVPT
    GSENLISLYNTCCCVWCVHAKEKVTDTEEAKEKVKQKLHLVAEKENAASEKEQRAIVTPSGRSKNYPIQI
    INQTPVHQGISPRTLNAWVKCIEEKKFSPEIVPMFIALSEGCLPYDLNGMLNAIGDHQGALQIVKDVINE
    EAADWNLRHPQVGPMPQGVLRNPTGSDIAGTTSSIEEQIEWTTREQDAVNVGGIYKQWIVLGLQKCVSMY
    NPVNILDIKQGPKEPFKDYVDRFYKALRAERTDPQVKTWMTQTLLIQNANPDCKSILKGLGMNPSLEEMP
    LACQGVGGPKYKAQMMAEAMKEAQSAVMMQNSGGPPRGPPRQPPRNIRCPNCGKFGHGLRDCISPRKKGC
    FKCGDLGHIMRNCPKMVNFLGNTPWGSGKPRNFPAMPLTPTAPPMPGMEDPAERMLLDYMKKGQQQKAES
    KQEKKERGPYEAAYNSLSSLFGTDQLQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A novel primate lentivirus was identified in Mandrillus sphinx. One of the newly isolated SIV strains was intravenously inoculated into two rhesus macaques and resulted in chronic infection. These SIVs do not cluster with SIVmndGB1, the former representative strain of SIVmnd, but form a new, independent lineage. These results indicate that these SIVmnds are a novel type of SIVmnd and have infected Cameroonian mandrills for a long time. To date, M. sphinx is the only primate species other than humans that is naturally infected with two different types of SIV (Takehisa et al., 2001).
  • Related Vaccine(s): Adenoviral vector Ad5 expressing SIV gag protein , DNA and poxvirus priming-boosting SHIV vaccine , HIV DNA and adenoviral vector Ad5 expressing SIV gag protein , HIV DNA vaccine Ad26/Ad5HVR48 encoding HIV or SIV env or gag , HIV DNA vaccine pHIS-SHIV-B , HIV DNA vaccine SIVmac239 Gag-Pol-Nef and mock Env with rAd5 boost
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.208
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
25. gag-pol
  • Gene Name : gag-pol
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Gene ID : 155348
  • NCBI Protein GI : 28872819
  • Locus Tag : HIV1gp1
  • Genbank Accession : AF033819
  • Protein Accession : NP_057849
  • Taxonomy ID : 11676
  • Gene Starting Position : 335
  • Gene Ending Position : 4641
  • Gene Strand (Orientation) : +
  • Protein Name : Gag-Pol
  • Protein pI : 9.02
  • Protein Weight : 152515.27
  • Protein Length : 1435
  • Protein Note : Pr160
  • DNA Sequence : Show Sequence
    >NC_001802.1:335-4641 Human immunodeficiency virus 1, complete genome
    GATGGGTGCGAGAGCGTCAGTATTAAGCGGGGGAGAATTAGATCGATGGGAAAAAATTCGGTTAAGGCCA
    GGGGGAAAGAAAAAATATAAATTAAAACATATAGTATGGGCAAGCAGGGAGCTAGAACGATTCGCAGTTA
    ATCCTGGCCTGTTAGAAACATCAGAAGGCTGTAGACAAATACTGGGACAGCTACAACCATCCCTTCAGAC
    AGGATCAGAAGAACTTAGATCATTATATAATACAGTAGCAACCCTCTATTGTGTGCATCAAAGGATAGAG
    ATAAAAGACACCAAGGAAGCTTTAGACAAGATAGAGGAAGAGCAAAACAAAAGTAAGAAAAAAGCACAGC
    AAGCAGCAGCTGACACAGGACACAGCAATCAGGTCAGCCAAAATTACCCTATAGTGCAGAACATCCAGGG
    GCAAATGGTACATCAGGCCATATCACCTAGAACTTTAAATGCATGGGTAAAAGTAGTAGAAGAGAAGGCT
    TTCAGCCCAGAAGTGATACCCATGTTTTCAGCATTATCAGAAGGAGCCACCCCACAAGATTTAAACACCA
    TGCTAAACACAGTGGGGGGACATCAAGCAGCCATGCAAATGTTAAAAGAGACCATCAATGAGGAAGCTGC
    AGAATGGGATAGAGTGCATCCAGTGCATGCAGGGCCTATTGCACCAGGCCAGATGAGAGAACCAAGGGGA
    AGTGACATAGCAGGAACTACTAGTACCCTTCAGGAACAAATAGGATGGATGACAAATAATCCACCTATCC
    CAGTAGGAGAAATTTATAAAAGATGGATAATCCTGGGATTAAATAAAATAGTAAGAATGTATAGCCCTAC
    CAGCATTCTGGACATAAGACAAGGACCAAAGGAACCCTTTAGAGACTATGTAGACCGGTTCTATAAAACT
    CTAAGAGCCGAGCAAGCTTCACAGGAGGTAAAAAATTGGATGACAGAAACCTTGTTGGTCCAAAATGCGA
    ACCCAGATTGTAAGACTATTTTAAAAGCATTGGGACCAGCGGCTACACTAGAAGAAATGATGACAGCATG
    TCAGGGAGTAGGAGGACCCGGCCATAAGGCAAGAGTTTTGGCTGAAGCAATGAGCCAAGTAACAAATTCA
    GCTACCATAATGATGCAGAGAGGCAATTTTAGGAACCAAAGAAAGATTGTTAAGTGTTTCAATTGTGGCA
    AAGAAGGGCACACAGCCAGAAATTGCAGGGCCCCTAGGAAAAAGGGCTGTTGGAAATGTGGAAAGGAAGG
    ACACCAAATGAAAGATTGTACTGAGAGACAGGCTAATTTTTTAGGGAAGATCTGGCCTTCCTACAAGGGA
    AGGCCAGGGAATTTTCTTCAGAGCAGACCAGAGCCAACAGCCCCACCAGAAGAGAGCTTCAGGTCTGGGG
    TAGAGACAACAACTCCCCCTCAGAAGCAGGAGCCGATAGACAAGGAACTGTATCCTTTAACTTCCCTCAG
    GTCACTCTTTGGCAACGACCCCTCGTCACAATAAAGATAGGGGGGCAACTAAAGGAAGCTCTATTAGATA
    CAGGAGCAGATGATACAGTATTAGAAGAAATGAGTTTGCCAGGAAGATGGAAACCAAAAATGATAGGGGG
    AATTGGAGGTTTTATCAAAGTAAGACAGTATGATCAGATACTCATAGAAATCTGTGGACATAAAGCTATA
    GGTACAGTATTAGTAGGACCTACACCTGTCAACATAATTGGAAGAAATCTGTTGACTCAGATTGGTTGCA
    CTTTAAATTTTCCCATTAGCCCTATTGAGACTGTACCAGTAAAATTAAAGCCAGGAATGGATGGCCCAAA
    AGTTAAACAATGGCCATTGACAGAAGAAAAAATAAAAGCATTAGTAGAAATTTGTACAGAGATGGAAAAG
    GAAGGGAAAATTTCAAAAATTGGGCCTGAAAATCCATACAATACTCCAGTATTTGCCATAAAGAAAAAAG
    ACAGTACTAAATGGAGAAAATTAGTAGATTTCAGAGAACTTAATAAGAGAACTCAAGACTTCTGGGAAGT
    TCAATTAGGAATACCACATCCCGCAGGGTTAAAAAAGAAAAAATCAGTAACAGTACTGGATGTGGGTGAT
    GCATATTTTTCAGTTCCCTTAGATGAAGACTTCAGGAAGTATACTGCATTTACCATACCTAGTATAAACA
    ATGAGACACCAGGGATTAGATATCAGTACAATGTGCTTCCACAGGGATGGAAAGGATCACCAGCAATATT
    CCAAAGTAGCATGACAAAAATCTTAGAGCCTTTTAGAAAACAAAATCCAGACATAGTTATCTATCAATAC
    ATGGATGATTTGTATGTAGGATCTGACTTAGAAATAGGGCAGCATAGAACAAAAATAGAGGAGCTGAGAC
    AACATCTGTTGAGGTGGGGACTTACCACACCAGACAAAAAACATCAGAAAGAACCTCCATTCCTTTGGAT
    GGGTTATGAACTCCATCCTGATAAATGGACAGTACAGCCTATAGTGCTGCCAGAAAAAGACAGCTGGACT
    GTCAATGACATACAGAAGTTAGTGGGGAAATTGAATTGGGCAAGTCAGATTTACCCAGGGATTAAAGTAA
    GGCAATTATGTAAACTCCTTAGAGGAACCAAAGCACTAACAGAAGTAATACCACTAACAGAAGAAGCAGA
    GCTAGAACTGGCAGAAAACAGAGAGATTCTAAAAGAACCAGTACATGGAGTGTATTATGACCCATCAAAA
    GACTTAATAGCAGAAATACAGAAGCAGGGGCAAGGCCAATGGACATATCAAATTTATCAAGAGCCATTTA
    AAAATCTGAAAACAGGAAAATATGCAAGAATGAGGGGTGCCCACACTAATGATGTAAAACAATTAACAGA
    GGCAGTGCAAAAAATAACCACAGAAAGCATAGTAATATGGGGAAAGACTCCTAAATTTAAACTGCCCATA
    CAAAAGGAAACATGGGAAACATGGTGGACAGAGTATTGGCAAGCCACCTGGATTCCTGAGTGGGAGTTTG
    TTAATACCCCTCCCTTAGTGAAATTATGGTACCAGTTAGAGAAAGAACCCATAGTAGGAGCAGAAACCTT
    CTATGTAGATGGGGCAGCTAACAGGGAGACTAAATTAGGAAAAGCAGGATATGTTACTAATAGAGGAAGA
    CAAAAAGTTGTCACCCTAACTGACACAACAAATCAGAAGACTGAGTTACAAGCAATTTATCTAGCTTTGC
    AGGATTCGGGATTAGAAGTAAACATAGTAACAGACTCACAATATGCATTAGGAATCATTCAAGCACAACC
    AGATCAAAGTGAATCAGAGTTAGTCAATCAAATAATAGAGCAGTTAATAAAAAAGGAAAAGGTCTATCTG
    GCATGGGTACCAGCACACAAAGGAATTGGAGGAAATGAACAAGTAGATAAATTAGTCAGTGCTGGAATCA
    GGAAAGTACTATTTTTAGATGGAATAGATAAGGCCCAAGATGAACATGAGAAATATCACAGTAATTGGAG
    AGCAATGGCTAGTGATTTTAACCTGCCACCTGTAGTAGCAAAAGAAATAGTAGCCAGCTGTGATAAATGT
    CAGCTAAAAGGAGAAGCCATGCATGGACAAGTAGACTGTAGTCCAGGAATATGGCAACTAGATTGTACAC
    ATTTAGAAGGAAAAGTTATCCTGGTAGCAGTTCATGTAGCCAGTGGATATATAGAAGCAGAAGTTATTCC
    AGCAGAAACAGGGCAGGAAACAGCATATTTTCTTTTAAAATTAGCAGGAAGATGGCCAGTAAAAACAATA
    CATACTGACAATGGCAGCAATTTCACCGGTGCTACGGTTAGGGCCGCCTGTTGGTGGGCGGGAATCAAGC
    AGGAATTTGGAATTCCCTACAATCCCCAAAGTCAAGGAGTAGTAGAATCTATGAATAAAGAATTAAAGAA
    AATTATAGGACAGGTAAGAGATCAGGCTGAACATCTTAAGACAGCAGTACAAATGGCAGTATTCATCCAC
    AATTTTAAAAGAAAAGGGGGGATTGGGGGGTACAGTGCAGGGGAAAGAATAGTAGACATAATAGCAACAG
    ACATACAAACTAAAGAATTACAAAAACAAATTACAAAAATTCAAAATTTTCGGGTTTATTACAGGGACAG
    CAGAAATCCACTTTGGAAAGGACCAGCAAAGCTCCTCTGGAAAGGTGAAGGGGCAGTAGTAATACAAGAT
    AATAGTGACATAAAAGTAGTGCCAAGAAGAAAAGCAAAGATCATTAGGGATTATGGAAAACAGATGGCAG
    GTGATGATTGTGTGGCAAGTAGACAGGATGAGGATTA
    
    
  • Protein Sequence : Show Sequence
    >NP_057849.4 Gag-Pol [Human immunodeficiency virus 1]
    MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQT
    GSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQG
    QMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAA
    EWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPT
    SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTAC
    QGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEG
    HQMKDCTERQANFLREDLAFLQGKAREFSSEQTRANSPTRRELQVWGRDNNSPSEAGADRQGTVSFNFPQ
    VTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAI
    GTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEK
    EGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGD
    AYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQY
    MDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWT
    VNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSK
    DLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPI
    QKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGR
    QKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYL
    AWVPAHKGIGGNEQVDKLVSAGIRKVLFLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKC
    QLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTI
    HTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIH
    NFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQD
    NSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine pCMN160 , NYVAC-HIV-1 , NYVAC-HIV-2
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.132
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
26. gag-pol SIV
  • Gene Name : gag-pol SIV
  • Sequence Strain (Species/Organism) : Simian immunodeficiency virus
  • NCBI Gene ID : 1490009
  • NCBI Protein GI : 22535297
  • Locus Tag : SIVgp1
  • Genbank Accession : M29973
  • Protein Accession : NP_687035
  • Taxonomy ID : 11723
  • Gene Starting Position : 896
  • Gene Ending Position : 5313
  • Gene Strand (Orientation) : +
  • Protein Name : Gag-Pol
  • Protein pI : 8.66
  • Protein Weight : 157171.22
  • Protein Length : 1472
  • DNA Sequence : Show Sequence
    >NC_001549.1:896-5313 Simian immunodeficiency virus, complete genome
    AATGGGCGGGGGTCACTCAGCACTGTCAGGGAGAAGCCTCGACACGTTCGAGAAGATTAGGCTACGTCCG
    AACGGGAAAAAGAAGTACCAAATTAAACATTTAATATGGGCAGGAAAAGAAATGGAACGATTTGGGTTAC
    ATGAGAAACTTTTAGAAACAAAAGAAGGCTGTCAAAAAATCATAGAAGTTTTAACCCCGTTGGAACCGAC
    AGGCTCCGAGGGGCTAAAAGCTCTGTTTAATTTGTGCTGCGTCATTTGGTGCATTCACGCAGAACAGAAA
    GTGAAAGACACAGAGGAAGCTGTAGTAACAGTTAAGCAACACTACCATCTAGTGGACAAAAATGAGAAAG
    CAGCTAAAAAGAAAAATGAGACAACAGCGCCACCTGGTGGCGAATCAAGAAATTACCCAGTAGTAAATCA
    GAATAATGCCTGGGTACACCAGCCTTTGTCTCCGCGCACGTTAAATGCGTGGGTCAAATGCGTGGAGGAA
    AAAAGGTGGGGAGCAGAAGTAGTCCCCATGTTCCAAGCACTCTCAGAGGGATGTCTCTCCTATGATGTAA
    ATCAGATGCTCAATGTAATAGGAGACCATCAGGGGGCATTACAAATTCTTAAGGAAGTCATTAATGAAGA
    AGCAGCAGAGTGGGACAGGACACACAGACCACCAGCTGGCCCGTTACCAGCAGGGCAGCTAAGAGACCCG
    ACAGGGTCAGATATAGCAGGAACTACCAGCTCAATTCAGGAACAAATAGAGTGGACCTTCAATGCCAATC
    CAAGAATAGACGTAGGGGCACAATACAGAAAATGGGTTATTTTGGGCTTACAAAAGGTAGTGCAGATGTA
    CAATCCCCAAAAGGTCCTAGACATTCGACAGGGACCTAAAGAACCCTTCCAGGACTATGTAGACAGATTC
    TATAAAGCCCTGAGAGCAGAACAAGCACCACAGGATGTTAAAAATTGGATGACACAAACTTTGCTTATCC
    AGAATGCCAATCCGGATTGTAAATTGATTCTGAAAGGATTGGGAATGAATCCAACCTTGGAGGAAATGCT
    AATAGCTTGCCAGGGAGTAGGAGGGCCACAACATAAGGCTAAGCTAATGGTAGAAATGATGAGTAATGGA
    CAGAATATGGTCCAAGTGGGACCTCAGAAAAAGGGCCCCCGAGGGCCGCTAAAATGCTTTAATTGTGGCA
    AATTTGGACATATGCAAAGGGAATGCAAGGCACCAAGACAGATCAAATGCTTTAAGTGCGGCAAAATTGG
    CCATATGGCAAAAGACTGCAAGAATGGACAGGCAAATTTTTTAGGGTATGGCCATTGGGGAGGAGCGAAA
    CCAAGAAATTTTGTGCAATACAGAGGAGACACAGTTGGTCTGGAACCAACAGCCCCCCCAATGGAAACAG
    CTTACGATCCAGCAAAGAAGCTCCTCCAGCAGTATGCAGAGAAGGGACAGCGCCTGAGAGAGGAGAGAGA
    ACAGACAAGGAAACAGAAGGAGAAAGAAGTGGAGGATGTTTCCTTGAGCTCCCTCTTTGGAGGAGACCAA
    TGAAACGAGTCATCATAGAAGGAACGCCAGTGCAAGCCTTGTTAGATACAGGAGCAGATGACACTATAAT
    TCAAGAAAAGGACTTGCACTTTCCCCCACATAAACCATGGCGTTCCAAGGTAGTAGGAGGTATAGGAGGA
    GGGATTCATGTCAAAGAATATCAGGGGGTACAAGTACAATTGGAGGATAAAATCATCACCGGCTCAATTC
    TAATAGGAAGTACACCAATCAATATTATAGGAAGAAATATTTTAGCTCAGGCAGGCATGAAATTAGTTAT
    GGGAGTTCTATCTAGTCAGATTGAGGAAACAAAAGTACAACTAAAAGAAGGGAAAGATGGACCTAAATTG
    AAACAATGGCCCTTATCAAGAGAAAAAATTGAAGCTTTAACAGAAATATGCAAACAAATGGAAGAGGAGG
    GAAAATTATCTAGGATAGGAGGAGAAAATCCTTATAATACACCAGTGTTTGCCATAAAGAAAAAGGATAA
    AACACAATGGAGAATGCTTGTAGATTTCAGGGAACTAAACAAAGCTACTCAAGACTTTTTTGAGGTTCAG
    CTGGGAATTCCTCACCCAGCGGGCCTTCAGAAAAAGAAGCAAATCACAGTAATAGACATAGGGGATGCCT
    ATTATTCAATACCATTATGCAAGGAATTCAGAAAATATACAGCATTTACCATCCCCTCAGTAAATAATAC
    AGGGCCAGGGATAAGGTATCAGTTCAATTGTCTGCCTCAGGGATGGAAAGGATCTCCTACAATTTTCCAG
    AATACGGCAGCAAACATTTTAGAGGAGATCAAAAGGCACACTCCTGGGTTAGAAATTGTCCAATACATGG
    ACGATTTGTGGTTGGCGTCAGACCATGATGAGACTAGACATAATCAACAGGTAGACATAGTAAGAAAGAT
    GCTGCTAGAAAAAGGTCTAGAAACCCCAGACAAGAAAGTCCAAAGAGAACCGCCATGGGAATGGATGGGG
    TATAAATTGCATCCGAATAAATGGACCATTAACAAAATAGAATTACCCCCCTTAGAAGGAGAATGGACAG
    TAAACAAAATACAGAAGGTAGTAGGAGTTCTAAATTGGGCAAGTCAAATTTATCCAGGAATTAAAACCAA
    ACATACCTGTGCCATGTTGAGAGGGAAAAAGAACCTCCTAGAAGAAATAGTATGGACAGAAGAGGCAGAG
    GCAGAATATAAGAACAATCAAGGGATAGTGCAGGAAACACAAGAAGGAACATACTATGACCCTCTCAAAG
    AATTAATAGCAACAGTTCAAAAGCAAGGAGAAGGGCAATGGACATACCAATTCACCCAAGAAGGGGCAGT
    ATTAAAGGTGGGAAGATATGCCAAGCAAAGAGAAACTCATACTAATGATCTAAGGACTCTAGCACACCTT
    GTCCAAAAAATCTGTAAGGAAGCACTTACCATTTGGGGAAGACTTCCACGAGTACAACTCCCAGTAGACA
    AGAAAACATGGGATATGTGGTGGCAGGACTATTGGCAAGTATCCTGGATACCAGAATGGGAGTTTGTTAG
    CACACCACTCCTAGTAAAACTGTGGTATTCCTTAGTAAAAGAACCAATCAAAGGAGAAGATGTTTATTAT
    GTGGATGGGGCAGCATCCAAAGTGACCAAATTAGGTAAGGCAGGATATCTGTCAGAGAGAGGAAAAAGTA
    GAATTAGGGAATTAGAAAACACCACTAACCAACAAGCAGAATTAACAGCAGTTAAGATGGCATTGGAGGA
    CAGTGGAGAAAATGTAAATATAGTCACAGATTCTCAATATGTAATGAACATCTTGACAGCATGTCCACAG
    GAAAGTAACTCACCCTTAGTGGAACAGATAATACAAGCCCTAATGAAAAAGAGGCAGGTCTACTTACAAT
    GGGTACCAGCTCATAAGGGGATAGGAGGCAATACAGAAATAGATAAATTAGTAAGCAAAGGAATAAGACA
    GATCCTCTTCTTAGATAGAATAGAAGAAGCACAAGATGACCATGCAAAGTACCATAACAATTGGAGAAGT
    ATGGTACAGGAATTTGGATTACCTAATATAGTAGCAAAAGAGATAGTAGCGGCATGTCCCAAATGCCAAA
    TAAGAGGAGAACCTAAGCATGGACAGGTAGACGCCTCCATTGAAACTTGGCAGATGGACTGCACCCATTT
    AGAAGGAAAAGTTATAATAGTAGCAGTACATGTAGCCAGTGGATTCATAGAAGCAGAGGTGATCCCAAGA
    GAAACTGGGAAGGAGACAGCACACTTTCTGCTGAAACTGTTAGCAAGATGGCCAGTGAAACATCTACACA
    CTGATAATGGCCCAAACTTTACCTCTCAGAATGTGGCAGCGGTGTGCTGGTGGGGTAATATAGAGCACAC
    CACTGGAATACCTTATAACCCACAGTCACAGGGTAGTGTAGAAAGCATGAACAGACAGCTCAAGGAAATC
    ATCTCTCAAATAAGAGATGATTGTGAGAGATTGGAGACAGCAGTGCAAATGGCTACGCATATCCACAATT
    TTAAAAGAAAGGGAGGAATAGGGGGTATCTCTAGTGCAGAAAGATTGGTTAATATGCTAACAACACAACT
    AGAACTAAATACTCTACAAAACCAAATCCAAAAAATTTTGAATTTTAAGGTCTACTACAGAGAAGGTAGA
    GATCCAGTGTGGAAAGGACCAGCGCGACTCATCTGGAAAGGAGAAGGCGCGGTGGTAATTAAAGAGGGGG
    AAGACATCAAGGTAGTCCCCAGGAGAAAGGCTAAGATTATCAAAGATTATGGAGAGAGAAAAACAATGGA
    TAGTGAGGGTAGTATGGAGGGTGTCAGAGAGGCAAATAAGCAGATGGAGGGGGATAGTGACTTACAAGAT
    CAGGAATA
    
    
  • Protein Sequence : Show Sequence
    >NP_687035.1 Gag-Pol [Simian immunodeficiency virus]
    MGGGHSALSGRSLDTFEKIRLRPNGKKKYQIKHLIWAGKEMERFGLHEKLLETKEGCQKIIEVLTPLEPT
    GSEGLKALFNLCCVIWCIHAEQKVKDTEEAVVTVKQHYHLVDKNEKAAKKKNETTAPPGGESRNYPVVNQ
    NNAWVHQPLSPRTLNAWVKCVEEKRWGAEVVPMFQALSEGCLSYDVNQMLNVIGDHQGALQILKEVINEE
    AAEWDRTHRPPAGPLPAGQLRDPTGSDIAGTTSSIQEQIEWTFNANPRIDVGAQYRKWVILGLQKVVQMY
    NPQKVLDIRQGPKEPFQDYVDRFYKALRAEQAPQDVKNWMTQTLLIQNANPDCKLILKGLGMNPTLEEML
    IACQGVGGPQHKAKLMVEMMSNGQNMVQVGPQKKGPRGPLKCFNCGKFGHMQRECKAPRQIKCFKCGKIG
    HMAKDCKNGQANFFRVWPLGRSETKKFCAIQRRHSWSGTNSPPNGNSLRSSKEAPPAVCREGTAPERGER
    TDKETEGERSGGCFLELPLWRRPMKRVIIEGTPVQALLDTGADDTIIQEKDLHFPPHKPWRSKVVGGIGG
    GIHVKEYQGVQVQLEDKIITGSILIGSTPINIIGRNILAQAGMKLVMGVLSSQIEETKVQLKEGKDGPKL
    KQWPLSREKIEALTEICKQMEEEGKLSRIGGENPYNTPVFAIKKKDKTQWRMLVDFRELNKATQDFFEVQ
    LGIPHPAGLQKKKQITVIDIGDAYYSIPLCKEFRKYTAFTIPSVNNTGPGIRYQFNCLPQGWKGSPTIFQ
    NTAANILEEIKRHTPGLEIVQYMDDLWLASDHDETRHNQQVDIVRKMLLEKGLETPDKKVQREPPWEWMG
    YKLHPNKWTINKIELPPLEGEWTVNKIQKVVGVLNWASQIYPGIKTKHTCAMLRGKKNLLEEIVWTEEAE
    AEYKNNQGIVQETQEGTYYDPLKELIATVQKQGEGQWTYQFTQEGAVLKVGRYAKQRETHTNDLRTLAHL
    VQKICKEALTIWGRLPRVQLPVDKKTWDMWWQDYWQVSWIPEWEFVSTPLLVKLWYSLVKEPIKGEDVYY
    VDGAASKVTKLGKAGYLSERGKSRIRELENTTNQQAELTAVKMALEDSGENVNIVTDSQYVMNILTACPQ
    ESNSPLVEQIIQALMKKRQVYLQWVPAHKGIGGNTEIDKLVSKGIRQILFLDRIEEAQDDHAKYHNNWRS
    MVQEFGLPNIVAKEIVAACPKCQIRGEPKHGQVDASIETWQMDCTHLEGKVIIVAVHVASGFIEAEVIPR
    ETGKETAHFLLKLLARWPVKHLHTDNGPNFTSQNVAAVCWWGNIEHTTGIPYNPQSQGSVESMNRQLKEI
    ISQIRDDCERLETAVQMATHIHNFKRKGGIGGISSAERLVNMLTTQLELNTLQNQIQKILNFKVYYREGR
    DPVWKGPARLIWKGEGAVVIKEGEDIKVVPRRKAKIIKDYGERKTMDSEGSMEGVREANKQMEGDSDLQD
    QE
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): NYVAC-SIV
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.138
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
27. gp120
  • Gene Name : gp120
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 2326505
  • Other Database IDs : CDD:278917
    GOA:O40515
    InterPro: IPR000777
    UniProtKB/TrEMBL: O40515
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein pI : 9.81
  • Protein Weight : 11668
  • Protein Length : 172
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >CAA74764.1 gp120, partial [Human immunodeficiency virus 1]
    NGSLAEGEVVIRSENFTDNAKTIIVQLNESVVINCTRPNNNTRKNIHLGRGRSVYATEKIIGNVKQAHCN
    ISRAKWNDTLKQIVEKLREQFGKNKTIVFNQSSGGDPEI
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine VlJns-tPA-gp120
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.335
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
28. gp120
  • Gene Name : gp120
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 7769646
  • Other Database IDs : CDD:278917
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : gp120
  • Protein pI : 5.17
  • Protein Weight : 14848.42
  • Protein Length : 201
  • Protein Note : isolated from a 37 year old injecting drug user; HIV-1 RNA was extracted from plasma; RNA was reverse transcribed and the gp120 region was amplified using nested PCR; sequence was obtained bi-directionally from cloned DNA
  • Protein Sequence : Show Sequence
    >AAF69493.1 gp120, partial [Human immunodeficiency virus 1]
    VPVWKDAETTLFCASDAKAHETEVHNVWATHACVPTDPNPQEIQLKNVTENFNMWKNNMVEQMQEDVISL
    WDQSLKPCVKLTPLCVTLNCTDATLTNSTYITNVSKIIGDITEEVRNCSFNMTTELRDKKQKVHALFL
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.616
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
29. HIV1 ENV
  • Gene Name : HIV1 ENV
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 1490266
  • Other Database IDs : CDD:197369
    GOA:Q76270
    InterPro: IPR000328
    PDB: 1I5X
    PDB: 1I5Y
    PDB: 1QR8
    PDB: 1QR9
    UniProtKB/TrEMBL: Q76270
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : GP41
  • Protein pI : 6.77
  • Protein Weight : 13958.9
  • Protein Length : 186
  • Protein Note : heptad repeat 1-heptad repeat 2 region (ectodomain) of the gp41 subunit of human immunodeficiency virus (HIV-1), and related domains; cd09909
  • Protein Sequence : Show Sequence
    >CAA58216.1 GP41, partial [Human immunodeficiency virus 1]
    FLGFLGAAGSTMGAASITLTVQARTLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLQ
    DQQLLGIWGCSGKHICTTTVPWNSSWSNKSLEEIWQNMTWMEWEREIDNYTGLI
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.504
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
30. Nef
  • Gene Name : Nef
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • VO ID : VO_0011261
  • NCBI Gene ID : 156110
  • NCBI Protein GI : 28872818
  • Locus Tag : HIV1gp9
  • Genbank Accession : AF033819
  • Protein Accession : NP_057857
  • Taxonomy ID : 11676
  • Gene Starting Position : 8342
  • Gene Ending Position : 8962
  • Gene Strand (Orientation) : +
  • Protein Name : Nef
  • Protein pI : 6.42
  • Protein Weight : 22179.3
  • Protein Length : 206
  • Protein Note : This particular nucleotide sequence has a premature stop codon in place of a well-conserved tryptophan codon at position 8712-8714 that truncates the HIV1 Nef protein sequence to a 123 amino acids-long N-terminal portion (not shown).
  • DNA Sequence : Show Sequence
    >NC_001802.1:8342-8962 Human immunodeficiency virus 1, complete genome
    GATGGGTGGCAAGTGGTCAAAAAGTAGTGTGATTGGATGGCCTACTGTAAGGGAAAGAATGAGACGAGCT
    GAGCCAGCAGCAGATAGGGTGGGAGCAGCATCTCGAGACCTGGAAAAACATGGAGCAATCACAAGTAGCA
    ATACAGCAGCTACCAATGCTGCTTGTGCCTGGCTAGAAGCACAAGAGGAGGAGGAGGTGGGTTTTCCAGT
    CACACCTCAGGTACCTTTAAGACCAATGACTTACAAGGCAGCTGTAGATCTTAGCCACTTTTTAAAAGAA
    AAGGGGGGACTGGAAGGGCTAATTCACTCCCAAAGAAGACAAGATATCCTTGATCTGTGGATCTACCACA
    CACAAGGCTACTTCCCTGATTAGCAGAACTACACACCAGGGCCAGGGGTCAGATATCCACTGACCTTTGG
    ATGGTGCTACAAGCTAGTACCAGTTGAGCCAGATAAGATAGAAGAGGCCAATAAAGGAGAGAACACCAGC
    TTGTTACACCCTGTGAGCCTGCATGGGATGGATGACCCGGAGAGAGAAGTGTTAGAGTGGAGGTTTGACA
    GCCGCCTAGCATTTCATCACGTGGCCCGAGAGCTGCATCCGGAGTACTTCAAGAACTGCTG
    
    
  • Protein Sequence : Show Sequence
    >NP_057857.2 Nef [Human immunodeficiency virus 1]
    MGGKWSKSSVIGWPTVRERMRRAEPAADRVGAASRDLEKHGAITSSNTAATNAACAWLEAQEEEEVGFPV
    TPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFG
    WCYKLVPVEPDKIEEANKGENTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEYFKNC
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Study compared the handling of overlapping 24-mer peptides from HIV Nef either mixed or covalently linked in tandem in one protein. With adjuvant, overlapping peptides were capable of protecting Balb/c mice against lethal viral challenge with 3 × 108 plaque forming units of vv-nef, whereas the intact protein was less protective (Zhang et al., 2009).
  • Related Vaccine(s): DNA vaccine expressing multiple HIV epitopes
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.184
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
31. nef
  • Gene Name : nef
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 2
  • NCBI Protein GI : 1845210
  • Other Database IDs : CDD:249884
  • Taxonomy ID : 11709
  • Gene Strand (Orientation) : ?
  • Protein Name : nef protein
  • Protein pI : 6.88
  • Protein Weight : 28422.79
  • Protein Length : 319
  • Protein Note : similar to HIV2BEN, GenBank Accession Number M30502, and to HIV2D194, GenBank Accession Number J04542
  • Protein Sequence : Show Sequence
    >AAB47785.1 nef protein [Human immunodeficiency virus 2]
    MGASGSKKLSKQSQGLRERLLRARGGGYVRQCSASGGESSQSQGGSGREQKSPSCEGQQYRQGDYMNTPW
    RTPAMEGQKESYKQQNMDDVDSDDNDQVGVSVTSRVPLRPMTYKLAVDMSHFIKEKGGLEGMFYSRDRHR
    ILDLYLEKEEGVIPDWQNYTHGPGVRYPMCFGWLWKLVPVNMSQEAEDDETNCLMHPAQTSRYDDIHGET
    LVWRFNSMLAYEYKAFTLYPEEFGHKSGLPEKEWKAKLKARGIPYSE
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV-2 DNA vaccine
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.306
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
32. pol
  • Gene Name : pol
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 7021456
  • Other Database IDs : CDD:278505
    CDD:133149
    CDD:238823
    CDD:278506
    CDD:284283
    CDD:284281
    CDD:278503
    CDD:259998
    CDD:280240
    CDD:279057
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein Name : pol
  • Protein pI : 7.77
  • Protein Weight : 90126.73
  • Protein Length : 918
  • Protein Note : long-term nonprogressor
  • Protein Sequence : Show Sequence
    >AAF35355.1 pol, partial [Human immunodeficiency virus 1]
    FFREDLAFPQGKAREFPSEQTRAISPARRELQVWGRDNNSLSEAGANRQGTVSFSFPQITLWQRPLVAIK
    IGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQVAIEICGHKAIGTVLIGPTPVNI
    IGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENP
    YNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFR
    KYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEI
    GQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLN
    WASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAELELAENREILKEPVHGVYYDPAKDLIAEIQKQGQG
    QWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKVAIESIVIWGKTPKFKLPIQKETWEAWWTEY
    WQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQ
    KTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGN
    EQVDKLVSAGIRKVLFLDGIDKAQEEHEKYHSNWRAMAGDFNLPPVVAKEIVACCDKCQLKGEAMHGQVD
    CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSNT
    VKAACW
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): DNA vaccine expressing multiple HIV epitopes , HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.186
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
33. pol
  • Gene Name : pol
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus strain SHIV-89.6
  • NCBI Protein GI : 2828038
  • Other Database IDs : CDD:133149
    CDD:295487
    CDD:278506
    CDD:238185
    CDD:284283
    CDD:284281
    CDD:278503
    CDD:259998
    CDD:280240
    CDD:279057
    CDD:278951
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : pol
  • Protein pI : 7.9
  • Protein Weight : 113326.45
  • Protein Length : 1139
  • Protein Note : Retropepsins, pepsin-like aspartate proteases; cd05482
  • Protein Sequence : Show Sequence
    >AAB99959.1 pol, partial [Simian-Human immunodeficiency virus]
    LELWERGTLCKAMQSPKKTGMLEMWKNGPCYGQMPRQTGGFFRPWSMGKEAPQFPHGSSASGADANCSPR
    GPSCGSAKELHAVGQAAERKAERKQREALQGGDRGFAAPQFSLWRRPVVTAHIEGQPVEVLLDTGADDSI
    VTGIELGPHYTPKIVGGIGGFINTKEYKNVEIEVLGKRIKGTIMTGDTPINIFGRNLLTALGMSLNFPIA
    KVEPVKVALKPGKDGPKLKQWPLSKEKIVALREICEKMEKDGQLEEAPPTNPYNTPTFAIKKKDKNKWRM
    LIDFRELNRVTQDFTEVQLGIPHPAGLAKRKRITVLDIGDAYFSIPLDEEFRQYTAFTLPSVNNAEPGKR
    YIYKVLPQGWKGSPAIFQYTMRHVLEPFRKANPDVTLVQYMDDILIASDRTDLEHDRVVLQSKELLNSIG
    FSTPEEKFQKDPPFQWMGYELWPTKWKLQKIELPQRETWTVNDIQKLVGVLNWAAQIYPGIKTKHLCRLI
    RGKMTLTEEVQWTEMAEAEYEENKIILSQEQEGCYYQEGKPLEATVIKSQDNQWSYKIHQEDKILKVGKF
    AKIKNTHTNGVRLLAHVIQKIGKEAIVIWGQVPKFHLPVEKDVWEQWWTDYWQVTWIPEWDFISTPPLVR
    LVFNLVKDPIEGEETYYTDGSCNKQSKEGKAGYITDRGKDKVKVLEQTTNQQAELEAFLMALTDSGPKAN
    IIVDSQYVMGIITGCPTESESRLVNQIIEEMIKKSEIYVAWVPAHKGIGGNQEIDHLVSQGIRQVLFLEK
    IEPAQEEHDKYHSNVKELVFKFGLPRIVARQIVDTCDKCHQKGEAIHGQANSDLGTWQMDCTHLEGKIII
    VAVHVASGFIEAEVIPQETGRQTALFLLKLAGRWPITHLHTDNGANFASQEVKMVAWWAGIEHTFGVPYN
    PQSQGVVEAMNHHLKNQIDRIREQANSVETIVLMAVHCMNFKRRGGIGDMTPAERLINMITTEQEIQFQQ
    SKNSKFKNFRVYYREGRDQLWKGPGELLWKGEGAVILKVGTDIKVVPRRKAKIIKDYGGGKEVDSSSHME
    DTGEAREVA
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.126
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
34. rev
  • Gene Name : rev
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus strain SHIV-89.6
  • NCBI Protein GI : 2828043
  • Other Database IDs : CDD:278833
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : rev
  • Protein pI : 9.94
  • Protein Weight : 12952.65
  • Protein Length : 173
  • Protein Note : REV protein (anti-repression trans-activator protein); pfam00424
  • Protein Sequence : Show Sequence
    >AAB99964.1 rev [Simian-Human immunodeficiency virus]
    MAGRSGDSDEELIRTVRLIKLLYQSNPPPSLEGTRQARRNRRRRWRERQRQIRSISERILGTYLGRSAEP
    VPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.167
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
35. rev from HIV 1
  • Gene Name : rev from HIV 1
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Gene ID : 155908
  • NCBI Protein GI : 9629359
  • Locus Tag : HIV1gp6
  • Genbank Accession : AF033819
  • Protein Accession : NP_057854
  • Taxonomy ID : 11676
  • Gene Starting Position : 5515
  • Gene Ending Position : 8198
  • Gene Strand (Orientation) : +
  • Protein Name : Rev
  • Protein pI : 9.36
  • Protein Weight : 12578.23
  • Protein Length : 116
  • DNA Sequence : Show Sequence
    >NC_001802.1:5515-8198 Human immunodeficiency virus 1, complete genome
    TATGGCAGGAAGAAGCGGAGACAGCGACGAAGAGCTCATCAGAACAGTCAGACTCATCAAGCTTCTCTAT
    CAAAGCAGTAAGTAGTACATGTAATGCAACCTATACCAATAGTAGCAATAGTAGCATTAGTAGTAGCAAT
    AATAATAGCAATAGTTGTGTGGTCCATAGTAATCATAGAATATAGGAAAATATTAAGACAAAGAAAAATA
    GACAGGTTAATTGATAGACTAATAGAAAGAGCAGAAGACAGTGGCAATGAGAGTGAAGGAGAAATATCAG
    CACTTGTGGAGATGGGGGTGGAGATGGGGCACCATGCTCCTTGGGATGTTGATGATCTGTAGTGCTACAG
    AAAAATTGTGGGTCACAGTCTATTATGGGGTACCTGTGTGGAAGGAAGCAACCACCACTCTATTTTGTGC
    ATCAGATGCTAAAGCATATGATACAGAGGTACATAATGTTTGGGCCACACATGCCTGTGTACCCACAGAC
    CCCAACCCACAAGAAGTAGTATTGGTAAATGTGACAGAAAATTTTAACATGTGGAAAAATGACATGGTAG
    AACAGATGCATGAGGATATAATCAGTTTATGGGATCAAAGCCTAAAGCCATGTGTAAAATTAACCCCACT
    CTGTGTTAGTTTAAAGTGCACTGATTTGAAGAATGATACTAATACCAATAGTAGTAGCGGGAGAATGATA
    ATGGAGAAAGGAGAGATAAAAAACTGCTCTTTCAATATCAGCACAAGCATAAGAGGTAAGGTGCAGAAAG
    AATATGCATTTTTTTATAAACTTGATATAATACCAATAGATAATGATACTACCAGCTATAAGTTGACAAG
    TTGTAACACCTCAGTCATTACACAGGCCTGTCCAAAGGTATCCTTTGAGCCAATTCCCATACATTATTGT
    GCCCCGGCTGGTTTTGCGATTCTAAAATGTAATAATAAGACGTTCAATGGAACAGGACCATGTACAAATG
    TCAGCACAGTACAATGTACACATGGAATTAGGCCAGTAGTATCAACTCAACTGCTGTTAAATGGCAGTCT
    AGCAGAAGAAGAGGTAGTAATTAGATCTGTCAATTTCACGGACAATGCTAAAACCATAATAGTACAGCTG
    AACACATCTGTAGAAATTAATTGTACAAGACCCAACAACAATACAAGAAAAAGAATCCGTATCCAGAGAG
    GACCAGGGAGAGCATTTGTTACAATAGGAAAAATAGGAAATATGAGACAAGCACATTGTAACATTAGTAG
    AGCAAAATGGAATAACACTTTAAAACAGATAGCTAGCAAATTAAGAGAACAATTTGGAAATAATAAAACA
    ATAATCTTTAAGCAATCCTCAGGAGGGGACCCAGAAATTGTAACGCACAGTTTTAATTGTGGAGGGGAAT
    TTTTCTACTGTAATTCAACACAACTGTTTAATAGTACTTGGTTTAATAGTACTTGGAGTACTGAAGGGTC
    AAATAACACTGAAGGAAGTGACACAATCACCCTCCCATGCAGAATAAAACAAATTATAAACATGTGGCAG
    AAAGTAGGAAAAGCAATGTATGCCCCTCCCATCAGTGGACAAATTAGATGTTCATCAAATATTACAGGGC
    TGCTATTAACAAGAGATGGTGGTAATAGCAACAATGAGTCCGAGATCTTCAGACCTGGAGGAGGAGATAT
    GAGGGACAATTGGAGAAGTGAATTATATAAATATAAAGTAGTAAAAATTGAACCATTAGGAGTAGCACCC
    ACCAAGGCAAAGAGAAGAGTGGTGCAGAGAGAAAAAAGAGCAGTGGGAATAGGAGCTTTGTTCCTTGGGT
    TCTTGGGAGCAGCAGGAAGCACTATGGGCGCAGCCTCAATGACGCTGACGGTACAGGCCAGACAATTATT
    GTCTGGTATAGTGCAGCAGCAGAACAATTTGCTGAGGGCTATTGAGGCGCAACAGCATCTGTTGCAACTC
    ACAGTCTGGGGCATCAAGCAGCTCCAGGCAAGAATCCTGGCTGTGGAAAGATACCTAAAGGATCAACAGC
    TCCTGGGGATTTGGGGTTGCTCTGGAAAACTCATTTGCACCACTGCTGTGCCTTGGAATGCTAGTTGGAG
    TAATAAATCTCTGGAACAGATTTGGAATCACACGACCTGGATGGAGTGGGACAGAGAAATTAACAATTAC
    ACAAGCTTAATACACTCCTTAATTGAAGAATCGCAAAACCAGCAAGAAAAGAATGAACAAGAATTATTGG
    AATTAGATAAATGGGCAAGTTTGTGGAATTGGTTTAACATAACAAATTGGCTGTGGTATATAAAATTATT
    CATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGCTGTACTTTCTATAGTGAATAGAGTT
    AGGCAGGGATATTCACCATTATCGTTTCAGACCCACCTCCCAACCCCGAGGGGACCCGACAGGCCCGAAG
    GAATAGAAGAAGAAGGTGGAGAGAGAGACAGAGACAGATCCATTCGATTAGTGAACGGATCCTTGGCACT
    TATCTGGGACGATCTGCGGAGCCTGTGCCTCTTCAGCTACCACCGCTTGAGAGACTTACTCTTGATTGTA
    ACGAGGATTGTGGAACTTCTGGGACGCAGGGGGTGGGAAGCCCTCAAATATTGGTGGAATCTCCTACAGT
    ATTGGAGTCAGGAACTAAAGAATA
    
    
  • Protein Sequence : Show Sequence
    >NP_057854.1 Rev [Human immunodeficiency virus 1]
    MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILGTYLGRSAEP
    VPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): DNA vaccine expressing multiple HIV epitopes , HIV DNA vaccine pHIS-SHIV-B , HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6) , HIV priming with DNA vaccine expressing HIV gp160 protein and boosted with Ad5/35 vector expressing the same protein , HIV recombinant vector vaccine MVA.HIVA encoding env and rev
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.174
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
36. Tat
  • Gene Name : Tat
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • VO ID : VO_0011262
  • NCBI Gene ID : 155871
  • NCBI Protein GI : 9629358
  • Locus Tag : HIV1gp5
  • Genbank Accession : AF033819
  • Protein Accession : NP_057853
  • Taxonomy ID : 11676
  • Gene Starting Position : 5376
  • Gene Ending Position : 7969
  • Gene Strand (Orientation) : +
  • Protein Name : Tat
  • Protein pI : 10.43
  • Protein Weight : 9638.3
  • Protein Length : 86
  • Protein Note : the length of Tat varies depending on virus strain or clade
  • DNA Sequence : Show Sequence
    >NC_001802.1:5376-7969 Human immunodeficiency virus 1, complete genome
    AATGGAGCCAGTAGATCCTAGACTAGAGCCCTGGAAGCATCCAGGAAGTCAGCCTAAAACTGCTTGTACC
    AATTGCTATTGTAAAAAGTGTTGCTTTCATTGCCAAGTTTGTTTCATAACAAAAGCCTTAGGCATCTCCT
    ATGGCAGGAAGAAGCGGAGACAGCGACGAAGAGCTCATCAGAACAGTCAGACTCATCAAGCTTCTCTATC
    AAAGCAGTAAGTAGTACATGTAATGCAACCTATACCAATAGTAGCAATAGTAGCATTAGTAGTAGCAATA
    ATAATAGCAATAGTTGTGTGGTCCATAGTAATCATAGAATATAGGAAAATATTAAGACAAAGAAAAATAG
    ACAGGTTAATTGATAGACTAATAGAAAGAGCAGAAGACAGTGGCAATGAGAGTGAAGGAGAAATATCAGC
    ACTTGTGGAGATGGGGGTGGAGATGGGGCACCATGCTCCTTGGGATGTTGATGATCTGTAGTGCTACAGA
    AAAATTGTGGGTCACAGTCTATTATGGGGTACCTGTGTGGAAGGAAGCAACCACCACTCTATTTTGTGCA
    TCAGATGCTAAAGCATATGATACAGAGGTACATAATGTTTGGGCCACACATGCCTGTGTACCCACAGACC
    CCAACCCACAAGAAGTAGTATTGGTAAATGTGACAGAAAATTTTAACATGTGGAAAAATGACATGGTAGA
    ACAGATGCATGAGGATATAATCAGTTTATGGGATCAAAGCCTAAAGCCATGTGTAAAATTAACCCCACTC
    TGTGTTAGTTTAAAGTGCACTGATTTGAAGAATGATACTAATACCAATAGTAGTAGCGGGAGAATGATAA
    TGGAGAAAGGAGAGATAAAAAACTGCTCTTTCAATATCAGCACAAGCATAAGAGGTAAGGTGCAGAAAGA
    ATATGCATTTTTTTATAAACTTGATATAATACCAATAGATAATGATACTACCAGCTATAAGTTGACAAGT
    TGTAACACCTCAGTCATTACACAGGCCTGTCCAAAGGTATCCTTTGAGCCAATTCCCATACATTATTGTG
    CCCCGGCTGGTTTTGCGATTCTAAAATGTAATAATAAGACGTTCAATGGAACAGGACCATGTACAAATGT
    CAGCACAGTACAATGTACACATGGAATTAGGCCAGTAGTATCAACTCAACTGCTGTTAAATGGCAGTCTA
    GCAGAAGAAGAGGTAGTAATTAGATCTGTCAATTTCACGGACAATGCTAAAACCATAATAGTACAGCTGA
    ACACATCTGTAGAAATTAATTGTACAAGACCCAACAACAATACAAGAAAAAGAATCCGTATCCAGAGAGG
    ACCAGGGAGAGCATTTGTTACAATAGGAAAAATAGGAAATATGAGACAAGCACATTGTAACATTAGTAGA
    GCAAAATGGAATAACACTTTAAAACAGATAGCTAGCAAATTAAGAGAACAATTTGGAAATAATAAAACAA
    TAATCTTTAAGCAATCCTCAGGAGGGGACCCAGAAATTGTAACGCACAGTTTTAATTGTGGAGGGGAATT
    TTTCTACTGTAATTCAACACAACTGTTTAATAGTACTTGGTTTAATAGTACTTGGAGTACTGAAGGGTCA
    AATAACACTGAAGGAAGTGACACAATCACCCTCCCATGCAGAATAAAACAAATTATAAACATGTGGCAGA
    AAGTAGGAAAAGCAATGTATGCCCCTCCCATCAGTGGACAAATTAGATGTTCATCAAATATTACAGGGCT
    GCTATTAACAAGAGATGGTGGTAATAGCAACAATGAGTCCGAGATCTTCAGACCTGGAGGAGGAGATATG
    AGGGACAATTGGAGAAGTGAATTATATAAATATAAAGTAGTAAAAATTGAACCATTAGGAGTAGCACCCA
    CCAAGGCAAAGAGAAGAGTGGTGCAGAGAGAAAAAAGAGCAGTGGGAATAGGAGCTTTGTTCCTTGGGTT
    CTTGGGAGCAGCAGGAAGCACTATGGGCGCAGCCTCAATGACGCTGACGGTACAGGCCAGACAATTATTG
    TCTGGTATAGTGCAGCAGCAGAACAATTTGCTGAGGGCTATTGAGGCGCAACAGCATCTGTTGCAACTCA
    CAGTCTGGGGCATCAAGCAGCTCCAGGCAAGAATCCTGGCTGTGGAAAGATACCTAAAGGATCAACAGCT
    CCTGGGGATTTGGGGTTGCTCTGGAAAACTCATTTGCACCACTGCTGTGCCTTGGAATGCTAGTTGGAGT
    AATAAATCTCTGGAACAGATTTGGAATCACACGACCTGGATGGAGTGGGACAGAGAAATTAACAATTACA
    CAAGCTTAATACACTCCTTAATTGAAGAATCGCAAAACCAGCAAGAAAAGAATGAACAAGAATTATTGGA
    ATTAGATAAATGGGCAAGTTTGTGGAATTGGTTTAACATAACAAATTGGCTGTGGTATATAAAATTATTC
    ATAATGATAGTAGGAGGCTTGGTAGGTTTAAGAATAGTTTTTGCTGTACTTTCTATAGTGAATAGAGTTA
    GGCAGGGATATTCACCATTATCGTTTCAGACCCACCTCCCAACCCCGAGGGGACCCGACAGGCCCGAAGG
    AATA
    
    
  • Protein Sequence : Show Sequence
    >NP_057853.1 Tat [Human immunodeficiency virus 1]
    MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLS
    KQPTSQPRGDPTGPKE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : HIV-1 DNA plasmids expressing Env, Gag and Tat, either alone or combined with the corresponding protein immunogens formulated in the MF59 adjuvant, resulted in protection against an experimental HIV-1 infection in C57Bl/6 mice (Bråve et al., 2007).
  • Related Vaccine(s): DNA vaccine expressing multiple HIV epitopes , HIV DNA vaccine pHIS-SHIV-B , HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.200
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
37. tat
  • Gene Name : tat
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus strain SHIV-89.6
  • NCBI Protein GI : 2828042
  • Other Database IDs : CDD:278940
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : tat
  • Protein pI : 10.4
  • Protein Weight : 11598.34
  • Protein Length : 158
  • Protein Note : Transactivating regulatory protein (Tat); pfam00539
  • Protein Sequence : Show Sequence
    >AAB99963.1 tat [Simian-Human immunodeficiency virus]
    MEPVDPRLEPWKHPGSKPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLS
    KQPSSQPRGDPTGPKEQKKKVERETETDPVH
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.159
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
38. tat
  • Gene Name : tat
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 2
  • NCBI Protein GI : 1845211
  • Other Database IDs : CDD:278940
  • Taxonomy ID : 11709
  • Gene Strand (Orientation) : ?
  • Protein Name : tat protein
  • Protein pI : 9.61
  • Protein Weight : 14481.48
  • Protein Length : 190
  • Protein Note : similar to HIV2BEN, GenBank Accession Number M30502, and to HIV2D194, GenBank Accession Number J04542
  • Protein Sequence : Show Sequence
    >AAB47786.1 tat protein [Human immunodeficiency virus 2]
    METPLKAPESSLKSYNEPSPCTSEWEVAAQELAKQGEELLAQLHRPLEACTNPCYCKKCSFHCQLCFLKK
    GLGIWYVRKGGRRRTPKRTKTHPPSTPDKSISIQTGDSRPTKKQKETPETPVATTSGLGR
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV-2 DNA vaccine
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.316
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
39. vif
  • Gene Name : vif
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus strain SHIV-89.6
  • NCBI Protein GI : 2828039
  • Other Database IDs : CDD:278957
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : vif
  • Protein pI : 10.5
  • Protein Weight : 24244.15
  • Protein Length : 273
  • Protein Note : Retroviral Vif (Viral infectivity) protein; pfam00559
  • Protein Sequence : Show Sequence
    >AAB99960.1 vif [Simian-Human immunodeficiency virus]
    MEEEKRWIAVPTWRIPERLERWHSLIKYLKYKTKDLQKVCYVPHFKVGWAWWTCSRVIFPLQEGSHLEVQ
    GYWHLTPEKGWLSTYAVRITWYSKNFWTDVTPNYADILLHSTYFPCFTAGEVRRAIRGEQLLSCCRFPRA
    HKYQVPSLQYLALKVVSDVRSQGENPTWKQWRRDNRRGLRMAKQNSRGDKQRGGKPPTKGANFPGLAKVL
    GILA
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.142
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
40. vpr
  • Gene Name : vpr
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus strain SHIV-89.6
  • NCBI Protein GI : 2828041
  • Other Database IDs : CDD:278923
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : vpr
  • Protein pI : 5.91
  • Protein Weight : 11514.23
  • Protein Length : 158
  • Protein Note : VPR/VPX protein; pfam00522
  • Protein Sequence : Show Sequence
    >AAB99962.1 vpr [Simian-Human immunodeficiency virus]
    MEERPPENEGPQREPWDEWVVEVLEELKEEALKHFDPRLLTALGNHIYNRHGDTLEGAGELIRILQRALF
    MHFRGGCIHSRIGQPGGGNPLSAIPPSRSML
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.257
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
41. vpu
  • Gene Name : vpu
  • Sequence Strain (Species/Organism) : Simian-Human immunodeficiency virus strain SHIV-89.6
  • NCBI Protein GI : 2828044
  • Other Database IDs : CDD:109608
  • Taxonomy ID : 57667
  • Gene Strand (Orientation) : ?
  • Protein Name : vpu
  • Protein pI : 4.6
  • Protein Weight : 8647.38
  • Protein Length : 138
  • Protein Note : Vpu protein; pfam00558
  • Protein Sequence : Show Sequence
    >AAB99965.1 vpu [Simian-Human immunodeficiency virus]
    MQPIQIAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEM
    GHHAPWDVDDL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.353
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
II. References
1. Bråve et al., 2007: Bråve A, Hinkula J, Cafaro A, Eriksson LE, Srivastava IK, Magnani M, Ensoli B, Barnett SW, Wahren B, Rollman E. Candidate HIV-1 gp140DeltaV2, Gag and Tat vaccines protect against experimental HIV-1/MuLV challenge. Vaccine. 2007; 25(39-40); 6882-6890. [PubMed: 17707956].
2. Takehisa et al., 2001: Takehisa J, Harada Y, Ndembi N, Mboudjeka I, Taniguchi Y, Ngansop C, Kuate S, Zekeng L, Ibuki K, Shimada T, Bikandou B, Yamaguchi-Kabata Y, Miura T, Ikeda M, Ichimura H, Kaptue L, Hayami M. Natural infection of wild-born mandrills (Mandrillus sphinx) with two different types of simian immunodeficiency virus. AIDS research and human retroviruses. 2001 Aug 10; 17(12); 1143-54. [PubMed: 11522184].
3. Zhang et al., 2009: Zhang H, Hong H, Li D, Ma S, Di Y, Stoten A, Haig N, Di Gleria K, Yu Z, Xu XN, McMichael A, Jiang S. Comparing pooled peptides with intact protein for accessing cross-presentation pathways for protective CD8+ and CD4+ T cells. The Journal of biological chemistry. 2009; 284(14); 9184-9191. [PubMed: 19193636].