VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Mycobacterium tuberculosis

Table of Contents
  1. Protective Antigens
    1. Ag85B from M. tuberculosis H37Rv
    2. Apa
    3. bfrA
    4. DnaK
    5. EsxA (ESAT-6)
    6. EsxB
    7. esxV
    8. esxW
    9. FbpA (Ag85A)
    10. FbpD
    11. HBHA
    12. KatG
    13. Mpt63
    14. MPT64
    15. MPT83
    16. Mtb72F
    17. PE20
    18. PepA
    19. PPE14
    20. PPE18
    21. PPE31
    22. PPE42
    23. PstS1
    24. PstS3
    25. Rv1813c
    26. Rv2660c
1. Ag85B from M. tuberculosis H37Rv
  • Gene Name : Ag85B from M. tuberculosis H37Rv
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012364
  • NCBI Gene ID : 885785
  • NCBI Protein GI : 15609023
  • Locus Tag : Rv1886c
  • Genbank Accession : AL123456
  • Protein Accession : NP_216402
  • Other Database IDs : EMBL: AE000516
    EMBL: AF198032
    EMBL: BX842578
    EMBL: U38939
    EMBL: X62398
    GenomeReviews: AE000516_GR
    GenomeReviews: AL123456_GR
    InterPro: IPR000801
    KEGG: mtc:MT1934
    KEGG: mtu:Rv1886c
    PDB: 1F0N
    PDB: 1F0P
    Pfam: PF00756
    PIR: C70516
    TIGR: MT1934
    TubercuList: Rv1886c
    UniProt: P31952
  • Taxonomy ID : 83332
  • Gene Starting Position : 2134889
  • Gene Ending Position : 2135866
  • Gene Strand (Orientation) : -
  • Protein Name : diacylglycerol acyltransferase/mycolyltransferase Ag85B
  • Protein pI : 5.72
  • Protein Weight : 33091.46
  • Protein Length : 325
  • Protein Note : Rv1886c, (MT1934, MTCY180.32), len: 325 aa. fbpB (alternate gene names: mpt59, 85B), precursor of the 85-B antigen (fibronectin-binding protein B) (mycolyl transferase 85B) (EC 2.3.1.-) (see citations below), highly similar to other Mycobacterial antigen precursors e.g. P12942|A85B_MYCBO ANTIGEN 85-B PRECURSOR from Mycobacterium bovis (323 aa); P21160|A85B_MYCKA ANTIGEN 85-B PRECURSOR from Mycobacterium kansasii (325 aa); etc. Also highly similar to Mycobacterium tuberculosis antigen precursors: Rv3804c|fbpA (338 aa), Rv0129c|fbpC2 (340 aa), and Rv3803c|fbpC1 (299 aa). TBparse score is 0.912.; mpt59; 85B
  • Protein Annotation : FUNCTION: Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity (UniProt: P31952)

    SUBCELLULAR LOCATION: Secreted protein (UniProt: P31952)

    SIMILARITY: Belongs to the mycobacterial A85 antigen family (UniProt: P31952)
  • DNA Sequence : Show Sequence
    >NC_000962.3:2134889-2135866 Mycobacterium tuberculosis H37Rv, complete genome
    GTCAGCCGGCGCCTAACGAACTCTGCAGGTCACCCTTCATGGCGTTGAGCTGAGCGCCCCAGTACTCCCA
    GCTGTGCGTGCCGTTGGGCGGGAAGTTGAACACGGCGTTGTGCCCGCCCGCGGCGTTGTACGCATCCTGG
    AACTTCAGGTTGCTGCTACGAACGAAGTTCTCCAAGAACTCGGCGGGTATGTTGGCACCGCCCAACTCGT
    TCGGGGTGCCGTTCCCGCAATAAACCCATAGCCGGGTGTTGTTTGCGACCAGCTTGGGGATCTGCTGCGT
    AGGGTCGTTGCGCTCCCATGCCGGGTCACTCGAGGGACCCCACATGTCTGCGGCCTTGTAACCGCCGGCG
    TCACCCATCGCGAGGCCGATCAGGCTAGGCCCCATCCCCTGAGAGGGGTCCAGCAGGGCCGACAGCGAGC
    CGGCGTAGATGAACTGCTGGGGGTGGTAGGCGGCCAAGATCATTGCCGACGAGCCGGCCATCGACAAGCC
    GATTGCAGCGCTGCCGGTGGGCTTCACGGCCCTGTTGGCGGACAACCATTGCGGCAGCTCGCTGGTCAGG
    AAGGTTTCCCACTTGTAAGTCTGGCAGCCAGCCTTACCGCAGGCCGGGCTGTACCAGTCGCTGTAGAAGC
    TGGACTGCCCGCCGACCGGCATGACTATCGACAGTCCCGACTGGTAGTACCACTCGAACGCCGGGGTGTT
    GATATCCCAGCCGTTGTAGTCGTCTTGGGCGCGCAGGCCGTCGAGCAGATAAACCGCAGGTGAGTTGTTC
    CCACCGCTCTGGAACTGAACCTTGATGTCGCGGCCCATCGACGGCGACGGCACCTGCAGGTACTCGACCG
    GCAGCCCCGGCCGGGAGAACGCGCCCGCGGTTGCCGCTCCGCCGGCAAGCCCCACCAGGCCCGGAAGGAC
    TACAGCCGCTGCCGTGCCGATCATCAATCGGCGTCCCCAAGCTCGAATCTTTCGGCTCACGTCTGTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_216402.1 diacylglycerol acyltransferase/mycolyltransferase Ag85B [Mycobacterium tuberculosis H37Rv]
    MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGG
    NNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETF
    LTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGD
    AGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKF
    QDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : In mice, a primary vaccination with Ag85B-encoding plasmid DNA (DNA-85B) was protective against Mycobacterium tuberculosis (MTB) infection and associated with Ag85B-specific CD4+ T cells producing IFN-gamma and controlling intramacrophagic MTB growth (Palma et al., 2007).
  • COG: COG0627R, under R: General function prediction only
  • Related Vaccine(s): Ag85B and ESAT-6 fusion protein , Arabinomannan-tetanus toxoid conjugate , LT-BCG- Ag85B /Rv3425 , M. tuberculosis DNA Vaccine encoding Ag85B Protein , M. tuberculosis DNA vaccine encoding Ag85B, MPT64 and MPT83 , MVA/IL-15/5Mtb vaccine , rBCG-Ag85A/ Ag85B
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.761
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
2. Apa
  • Gene Name : Apa
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0011175
  • NCBI Gene ID : 885896
  • NCBI Protein GI : 57116926
  • Locus Tag : Rv1860
  • Genbank Accession : AL123456
  • Protein Accession : YP_177849
  • Taxonomy ID : 83332
  • Gene Starting Position : 2107735
  • Gene Ending Position : 2108712
  • Gene Strand (Orientation) : +
  • Protein Name : hypothetical protein
  • Protein pI : 4.7
  • Protein Weight : 30636.65
  • Protein Length : 325
  • Protein Note : Rv1860, (MT1908, MTCY359.0013), len: 325 aa. apa (alternate gene names: mpt32, modD), Ala-, Pro-rich 45/47 kDa secreted protein, very similar to P46842|N43L_MYCLE from Mycobacterium leprae (287 aa), FASTA scores: opt: 1166, E(): 0, (66.4% identity in 298 aa overlap). Known to be glycosylated fibronectin-binding protein (see some citations). CHANGES IN THE MANNOSYLATION PATTERN OF THIS PROTEIN AFFECT ITS ABILITY TO STIMULATE T-LYMPHOCYTE RESPONSE. MAJOR IMMUNODOMINANT ANTIGEN THAT HAS POTENTIAL AS A VACCINE AGAINST TUBERCULOSIS. APA-ELISA COULD BE USED IN DIAGNOSIS. TBparse score is 0.924.; mpt32; modD
  • DNA Sequence : Show Sequence
    >NC_000962.3:2107735-2108712 Mycobacterium tuberculosis H37Rv, complete genome
    CATGCATCAGGTGGACCCCAACTTGACACGTCGCAAGGGACGATTGGCGGCACTGGCTATCGCGGCGATG
    GCCAGCGCCAGCCTGGTGACCGTTGCGGTGCCCGCGACCGCCAACGCCGATCCGGAGCCAGCGCCCCCGG
    TACCCACAACGGCCGCCTCGCCGCCGTCGACCGCTGCAGCGCCACCCGCACCGGCGACACCTGTTGCCCC
    CCCACCACCGGCCGCCGCCAACACGCCGAATGCCCAGCCGGGCGATCCCAACGCAGCACCTCCGCCGGCC
    GACCCGAACGCACCGCCGCCACCTGTCATTGCCCCAAACGCACCCCAACCTGTCCGGATCGACAACCCGG
    TTGGAGGATTCAGCTTCGCGCTGCCTGCTGGCTGGGTGGAGTCTGACGCCGCCCACTTCGACTACGGTTC
    AGCACTCCTCAGCAAAACCACCGGGGACCCGCCATTTCCCGGACAGCCGCCGCCGGTGGCCAATGACACC
    CGTATCGTGCTCGGCCGGCTAGACCAAAAGCTTTACGCCAGCGCCGAAGCCACCGACTCCAAGGCCGCGG
    CCCGGTTGGGCTCGGACATGGGTGAGTTCTATATGCCCTACCCGGGCACCCGGATCAACCAGGAAACCGT
    CTCGCTCGACGCCAACGGGGTGTCTGGAAGCGCGTCGTATTACGAAGTCAAGTTCAGCGATCCGAGTAAG
    CCGAACGGCCAGATCTGGACGGGCGTAATCGGCTCGCCCGCGGCGAACGCACCGGACGCCGGGCCCCCTC
    AGCGCTGGTTTGTGGTATGGCTCGGGACCGCCAACAACCCGGTGGACAAGGGCGCGGCCAAGGCGCTGGC
    CGAATCGATCCGGCCTTTGGTCGCCCCGCCGCCGGCGCCGGCACCGGCTCCTGCAGAGCCCGCTCCGGCG
    CCGGCGCCGGCCGGGGAAGTCGCTCCTACCCCGACGACACCGACACCGCAGCGGACCTTACCGGCCTG
    
    
  • Protein Sequence : Show Sequence
    >YP_177849.1 hypothetical protein Rv1860 [Mycobacterium tuberculosis H37Rv]
    MHQVDPNLTRRKGRLAALAIAAMASASLVTVAVPATANADPEPAPPVPTTAASPPSTAAAPPAPATPVAP
    PPPAAANTPNAQPGDPNAAPPPADPNAPPPPVIAPNAPQPVRIDNPVGGFSFALPAGWVESDAAHFDYGS
    ALLSKTTGDPPFPGQPPPVANDTRIVLGRLDQKLYASAEATDSKAAARLGSDMGEFYMPYPGTRINQETV
    SLDANGVSGSASYYEVKFSDPSKPNGQIWTGVIGSPAANAPDAGPPQRWFVVWLGTANNPVDKGAAKALA
    ESIRPLVAPPPAPAPAPAEPAPAPAPAGEVAPTPTTPTPQRTLPA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : We show that the 50- to 55-kDa Apa protein, specified by the Rv1860 gene of M. tuberculosis, can elicit both lymphoproliferative response and gamma interferon (IFN-gamma) production. A poxvirus recombinant expressing the Apa protein conferred a significant level of protective immunity in guinea pigs against a challenge dose of virulent M. tuberculosis (Kumar et al., 2003).
  • Related Vaccine(s): M. tuberculosis DNA Vaccine APADNA priming and APAMVA boosting
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.588
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
3. bfrA
  • Gene Name : bfrA
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • NCBI Gene ID : 885767
  • NCBI Protein GI : 15609013
  • Locus Tag : Rv1876
  • Genbank Accession : AL123456
  • Protein Accession : NP_216392
  • Taxonomy ID : 83332
  • Gene Starting Position : 2125339
  • Gene Ending Position : 2125818
  • Gene Strand (Orientation) : +
  • Protein Name : bacterioferritin BfrA
  • Protein pI : 4.23
  • Protein Weight : 17744.75
  • Protein Length : 159
  • Protein Note : Also known as bfr
  • DNA Sequence : Show Sequence
    >NC_000962.3:2125339-2125818 Mycobacterium tuberculosis H37Rv, complete genome
    CATGCAAGGTGATCCCGATGTTCTGCGCCTGCTCAACGAACAATTGACCAGCGAGCTCACCGCTATCAAC
    CAATACTTTCTGCACTCCAAGATGCAGGACAACTGGGGTTTTACCGAGCTGGCGGCCCACACCCGCGCGG
    AGTCGTTCGACGAAATGCGGCACGCCGAGGAAATCACCGATCGCATCTTGTTGCTGGATGGTTTGCCGAA
    CTACCAGCGCATCGGTTCGTTGCGTATCGGCCAGACGCTCCGCGAGCAATTTGAGGCCGATCTGGCGATC
    GAATACGACGTGTTGAATCGTCTCAAGCCAGGAATCGTCATGTGCCGGGAGAAACAGGACACCACCAGCG
    CCGTACTGCTGGAGAAAATCGTTGCCGACGAGGAAGAACACATCGACTACTTGGAAACGCAGCTGGAGCT
    GATGGACAAGCTAGGAGAGGAGCTTTACTCGGCGCAGTGCGTCTCTCGCCCACCGACCTG
    
    
  • Protein Sequence : Show Sequence
    >NP_216392.1 bacterioferritin BfrA [Mycobacterium tuberculosis H37Rv]
    MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPN
    YQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLEL
    MDKLGEELYSAQCVSRPPT
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mycobacterium frA (or called MMP-II) is one of the immunodominant antigens (Mukai et al., 2014).
  • Related Vaccine(s): BCG-DHTM
  • Localization(Probability): Cytoplasmic
    (Prob.=0.997)
  • Adhesin Probability: 0.098
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
4. DnaK
  • Gene Name : DnaK
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012408
  • NCBI Gene ID : 885946
  • NCBI Protein GI : 15607491
  • Locus Tag : Rv0350
  • Genbank Accession : AL123456
  • Protein Accession : NP_214864
  • Taxonomy ID : 83332
  • Gene Starting Position : 419834
  • Gene Ending Position : 421711
  • Gene Strand (Orientation) : +
  • Protein Name : chaperone protein DnaK
  • Protein pI : 4.59
  • Protein Weight : 61176.37
  • Protein Length : 625
  • Protein Note : heat shock protein 70; assists in folding of nascent polypeptide chains; refolding of misfolded proteins; utilizes ATPase activity to help fold; co-chaperones are DnaJ and GrpE; multiple copies in some bacteria
  • DNA Sequence : Show Sequence
    >NC_000962.3:419834-421711 Mycobacterium tuberculosis H37Rv, complete genome
    CATGGCTCGTGCGGTCGGGATCGACCTCGGGACCACCAACTCCGTCGTCTCGGTTCTGGAAGGTGGCGAC
    CCGGTCGTCGTCGCCAACTCCGAGGGCTCCAGGACCACCCCGTCAATTGTCGCGTTCGCCCGCAACGGTG
    AGGTGCTGGTCGGCCAGCCCGCCAAGAACCAGGCAGTGACCAACGTCGATCGCACCGTGCGCTCGGTCAA
    GCGACACATGGGCAGCGACTGGTCCATAGAGATTGACGGCAAGAAATACACCGCGCCGGAGATCAGCGCC
    CGCATTCTGATGAAGCTGAAGCGCGACGCCGAGGCCTACCTCGGTGAGGACATTACCGACGCGGTTATCA
    CGACGCCCGCCTACTTCAATGACGCCCAGCGTCAGGCCACCAAGGACGCCGGCCAGATCGCCGGCCTCAA
    CGTGCTGCGGATCGTCAACGAGCCGACCGCGGCCGCGCTGGCCTACGGCCTCGACAAGGGCGAGAAGGAG
    CAGCGAATCCTGGTCTTCGACTTGGGTGGTGGCACTTTCGACGTTTCCCTGCTGGAGATCGGCGAGGGTG
    TGGTTGAGGTCCGTGCCACTTCGGGTGACAACCACCTCGGCGGCGACGACTGGGACCAGCGGGTCGTCGA
    TTGGCTGGTGGACAAGTTCAAGGGCACCAGCGGCATCGATCTGACCAAGGACAAGATGGCGATGCAGCGG
    CTGCGGGAAGCCGCCGAGAAGGCAAAGATCGAGCTGAGTTCGAGTCAGTCCACCTCGATCAACCTGCCCT
    ACATCACCGTCGACGCCGACAAGAACCCGTTGTTCTTAGACGAGCAGCTGACCCGCGCGGAGTTCCAACG
    GATCACTCAGGACCTGCTGGACCGCACTCGCAAGCCGTTCCAGTCGGTGATCGCTGACACCGGCATTTCG
    GTGTCGGAGATCGATCACGTTGTGCTCGTGGGTGGTTCGACCCGGATGCCCGCGGTGACCGATCTGGTCA
    AGGAACTCACCGGCGGCAAGGAACCCAACAAGGGCGTCAACCCCGATGAGGTTGTCGCGGTGGGAGCCGC
    TCTGCAGGCCGGCGTCCTCAAGGGCGAGGTGAAAGACGTTCTGCTGCTTGATGTTACCCCGCTGAGCCTG
    GGTATCGAGACCAAGGGCGGGGTGATGACCAGGCTCATCGAGCGCAACACCACGATCCCCACCAAGCGGT
    CGGAGACTTTCACCACCGCCGACGACAACCAACCGTCGGTGCAGATCCAGGTCTATCAGGGGGAGCGTGA
    GATCGCCGCGCACAACAAGTTGCTCGGGTCCTTCGAGCTGACCGGCATCCCGCCGGCGCCGCGGGGGATT
    CCGCAGATCGAGGTCACTTTCGACATCGACGCCAACGGCATTGTGCACGTCACCGCCAAGGACAAGGGCA
    CCGGCAAGGAGAACACGATCCGAATCCAGGAAGGCTCGGGCCTGTCCAAGGAAGACATTGACCGCATGAT
    CAAGGACGCCGAAGCGCACGCCGAGGAGGATCGCAAGCGTCGCGAGGAGGCCGATGTTCGTAATCAAGCC
    GAGACATTGGTCTACCAGACGGAGAAGTTCGTCAAAGAACAGCGTGAGGCCGAGGGTGGTTCGAAGGTAC
    CTGAAGACACGCTGAACAAGGTTGATGCCGCGGTGGCGGAAGCGAAGGCGGCACTTGGCGGATCGGATAT
    TTCGGCCATCAAGTCGGCGATGGAGAAGCTGGGCCAGGAGTCGCAGGCTCTGGGGCAAGCGATCTACGAA
    GCAGCTCAGGCTGCGTCACAGGCCACTGGCGCTGCCCACCCCGGCGGCGAGCCGGGCGGTGCCCACCCCG
    GCTCGGCTGATGACGTTGTGGACGCGGAGGTGGTCGACGACGGCCGGGAGGCCAAGTG
    
    
  • Protein Sequence : Show Sequence
    >NP_214864.1 chaperone protein DnaK [Mycobacterium tuberculosis H37Rv]
    MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARNGEVLVGQPAKNQAVTNVDRTVRSVK
    RHMGSDWSIEIDGKKYTAPEISARILMKLKRDAEAYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLN
    VLRIVNEPTAAALAYGLDKGEKEQRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDQRVVD
    WLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQR
    ITQDLLDRTRKPFQSVIADTGISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA
    LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSETFTTADDNQPSVQIQVYQGERE
    IAAHNKLLGSFELTGIPPAPRGIPQIEVTFDIDANGIVHVTAKDKGTGKENTIRIQEGSGLSKEDIDRMI
    KDAEAHAEEDRKRREEADVRNQAETLVYQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGSDI
    SAIKSAMEKLGQESQALGQAIYEAAQAASQATGAAHPGGEPGGAHPGSADDVVDAEVVDDGREAK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : In an ex vivo transfection approach with a retroviral vector a single antigen (hsp70) could evoke strong protection in mice (Lowrie et al., 1997).
  • Related Vaccine(s): BCG-DHTM
  • Localization(Probability): Cytoplasmic
    (Prob.=0.997)
  • Adhesin Probability: 0.290
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
5. EsxA (ESAT-6)
  • Gene Name : EsxA (ESAT-6)
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0010919
  • NCBI Gene ID : 886209
  • NCBI Protein GI : 57117165
  • Locus Tag : Rv3875
  • Genbank Accession : AL123456
  • Protein Accession : YP_178023
  • Other Database IDs : EMBL: AE000516
    EMBL: AF004671
    EMBL: AF420491
    EMBL: BX842584
    EMBL: X79562
    GenomeReviews: AE000516_GR
    GenomeReviews: AL123456_GR
    InterPro: IPR010310
    KEGG: mtc:MT3989
    KEGG: mtu:Rv3875
    PDB: 1WA8
    Pfam: PF06013
    PIR: A70803
    TIGR: MT3989
    TubercuList: Rv3875
    UniProt: P0A564
  • Taxonomy ID : 83332
  • Gene Starting Position : 4352608
  • Gene Ending Position : 4352895
  • Gene Strand (Orientation) : +
  • Protein Name : ESAT-6 protein EsxA
  • Protein pI : 4.19
  • Protein Weight : 9605.81
  • Protein Length : 95
  • Protein Note : Rv3875, (MT3989, MTV027.10), len: 95 aa. esxA, early secretory antigenic target (see citations below), identical to Q57165|O84901|ESAT6 EARLY SECRETORY ANTIGENIC TARGET from Mycobacterium bovis (94 aa), FASTA scores: opt: 596, E(): 4.6e-33, (100.0% identity in 94 aa overlap). Also similar to Q50206|ESA6_MYCLE|ESAT6|ESX|L45|ML0049|MLCB628.12c 6 KDA EARLY SECRETORY ANTIGENIC TARGET HOMOLOG (ESAT-6-LIKE PROTEIN) (L-ESAT) from Mycobacterium leprae (95 aa), FASTA scores: opt: 236, E(): 3.3e-09, (36.25% identity in 91 aa overlap); and weak similarity with others proteins ESAT-like from Mycobacterium leprae. Also some similarity with O53266|ES69_MYCTU|Rv3019c|MT3104|MTV012.33c PUTATIVE SECRETED ESAT-6 LIKE PROTEIN 9 from Mycobacterium tuberculosis (96 aa), FASTA scores: opt: 131, E(): 0.03, (26.15% identity in 88 aa overlap); and other ESAT-like protein. Contains probable coiled-coil from 56 to 92 aa. BELONGS TO THE ESAT6 FAMILY. Note that previously known as esat-6.; esat-6
  • Protein Annotation : FUNCTION: Not known. Elicits high level of IFN-gamma from memory effector cells during the first phase of a protective immune response (UniProt: P0A564)

    SUBCELLULAR LOCATION: Secreted protein (UniProt: P0A564)

    SIMILARITY: Belongs to the ESAT-6 (esx) family (UniProt: P0A564)
  • DNA Sequence : Show Sequence
    >NC_000962.3:4352608-4352895 Mycobacterium tuberculosis H37Rv, complete genome
    CATGACAGAGCAGCAGTGGAATTTCGCGGGTATCGAGGCCGCGGCAAGCGCAATCCAGGGAAATGTCACG
    TCCATTCATTCCCTCCTTGACGAGGGGAAGCAGTCCCTGACCAAGCTCGCAGCGGCCTGGGGCGGTAGCG
    GTTCGGAGGCGTACCAGGGTGTCCAGCAAAAATGGGACGCCACGGCTACCGAGCTGAACAACGCGCTGCA
    GAACCTGGCGCGGACGATCAGCGAAGCCGGTCAGGCAATGGCTTCGACCGAAGGCAACGTCACTGGGATG
    TTCGCATA
    
    
  • Protein Sequence : Show Sequence
    >YP_178023.1 ESAT-6 protein EsxA [Mycobacterium tuberculosis H37Rv]
    MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ
    NLARTISEAGQAMASTEGNVTGMFA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The heterologous prime-boost strategy of live Salmonella vaccine expressing Mycobacterium tuberculosis fusion antigen Age5B-ESAT6 (esxA) from the chromosome followed by a systemic boost of antigen and adjuvant reduced the levels of M. tuberculosis bacteria in the lungs and spleen to the same extent as BCG. Additionally, this vaccination regimen was observed to be statistically equivalent in terms of protection to immunisation with BCG (Hall et al., 2009).
    In a prophylactic vaccine model, immunization with the Mycobacterium tuberculosis protein ESAT-6 with LANAC adjuvant elicited significant protective immunity against aerosol challenge with virulent M. tuberculosis (Zaks et al., 2006).
  • COG: COG4842S, under S: Function unknown
  • Related Vaccine(s): Ag85B and ESAT-6 fusion protein , attenuated M. bovis strain WAg539 , MVA/IL-15/5Mtb vaccine , recombinant S. typhimurium secreting M. tuberculosis ESAT-6
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.865
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
6. EsxB
  • Gene Name : EsxB
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0010951
  • NCBI Gene ID : 886194
  • NCBI Protein GI : 15611010
  • Locus Tag : Rv3874
  • Genbank Accession : AF004671
  • Protein Accession : NP_218391
  • 3D structure: PDB ID : 3FAV
  • Other Database IDs : EMBL: AE000516
    EMBL: AF004671
    EMBL: AF419854
    EMBL: BX842584
    GenomeReviews: AE000516_GR
    GenomeReviews: AL123456_GR
    InterPro: IPR010310
    KEGG: mtc:MT3988
    KEGG: mtu:Rv3874
    Pfam: PF06013
    PIR: H70802
    SMR: P0A566
    TIGR: MT3988
    TubercuList: Rv3874
    UniProt: P0A566
  • Taxonomy ID : 83332
  • Gene Starting Position : 4352273
  • Gene Ending Position : 4352575
  • Gene Strand (Orientation) : +
  • Protein Name : ESAT-6-like protein EsxB
  • Protein pI : 4.31
  • Protein Weight : 10396.66
  • Protein Length : 100
  • Protein Note : Rv3874, (MT3988, MTV027.09), len: 100 aa. esxB, 10 KDA culture filtrate antigen (see citations below, especially first), highly similar to O33084|CF10_MYCLE|ML0050|MLCB628.13c 10 KDA CULTURE FILTRATE ANTIGEN CFP10 HOMOLOG from Mycobacterium leprae (99 aa), FASTA scores: opt: 237, E(): 2.4e-08, (39.4% identity in 99 aa overlap). Also similar to O05440|ES6D_MYCTU|Rv3905c|MT4024|MTCY15F10.06 PUTATIVE ESAT-6 LIKE PROTEIN 13 from Mycobacterium tuberculosis (103 aa) FASTA scores: opt: 126, E(): 0.18, (23.1% identity in 91 aa overlap); and shows some similarity with other proteins from Mycobacterium tuberculosis. Contains probable coiled-coil from aa 49-93. BELONGS TO THE ESAT6 FAMILY. Note that previously known as lhp (alternate gene name: cfp10).; lhp, cfp10
  • Protein Annotation : SUBCELLULAR LOCATION: Secreted protein (UniProt: P0A566)

    SIMILARITY: Belongs to the ESAT-6 (esx) family (UniProt: P0A566)
  • DNA Sequence : Show Sequence
    >NC_000962.3:4352273-4352575 Mycobacterium tuberculosis H37Rv, complete genome
    CATGGCAGAGATGAAGACCGATGCCGCTACCCTCGCGCAGGAGGCAGGTAATTTCGAGCGGATCTCCGGC
    GACCTGAAAACCCAGATCGACCAGGTGGAGTCGACGGCAGGTTCGTTGCAGGGCCAGTGGCGCGGCGCGG
    CGGGGACGGCCGCCCAGGCCGCGGTGGTGCGCTTCCAAGAAGCAGCCAATAAGCAGAAGCAGGAACTCGA
    CGAGATCTCGACGAATATTCGTCAGGCCGGCGTCCAATACTCGAGGGCCGACGAGGAGCAGCAGCAGGCG
    CTGTCCTCGCAAATGGGCTTCTG
    
    
  • Protein Sequence : Show Sequence
    >NP_218391.1 ESAT-6-like protein EsxB [Mycobacterium tuberculosis H37Rv]
    MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELD
    EISTNIRQAGVQYSRADEEQQQALSSQMGF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The 10-kDa culture filtrate protein (CFP-10, esxB) and 6-kDa early secretory antigen of T cells (ESAT-6) are secreted in abundance by Mycobacterium tuberculosis. Study demonstrated that protective immunity is induced by CFP-10 DNA vaccination in C3H mice as measured by a CFU reduction in the lung and spleen 4 and 8 weeks after challenge with M. tuberculosis (Wu et al., 2008).
  • Related Vaccine(s): attenuated M. bovis strain WAg539
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.574
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
7. esxV
  • Gene Name : esxV
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • NCBI Protein GI : NP_218136
  • Other Database IDs : CDD:310537
  • Taxonomy ID : 83332
  • Gene Strand (Orientation) : ?
  • Protein Name : ESAT-6 like protein EsxV
  • Protein pI : 4.62
  • Protein Weight : 10489.63
  • Protein Length : 170
  • Protein Note : Proteins of 100 residues with WXG; pfam06013
  • Protein Sequence : Show Sequence
    >NP_218136.1 ESAT-6 like protein EsxV [Mycobacterium tuberculosis H37Rv]
    MTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANA
    HGQKVQAAGNNMAQTDSAVGSSWA
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : ID93/GLA-SE protects against TB and MDR-TB in animals.(Bertholet et al., 2010)
  • Related Vaccine(s): ID93/GLA-SE
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.790
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
8. esxW
  • Gene Name : esxW
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • NCBI Protein GI : NP_218137
  • Other Database IDs : CDD:310537
  • Taxonomy ID : 83332
  • Gene Strand (Orientation) : ?
  • Protein Name : ESAT-6 like protein EsxW
  • Protein pI : 5.09
  • Protein Weight : 11866.28
  • Protein Length : 174
  • Protein Note : Proteins of 100 residues with WXG; pfam06013
  • Protein Sequence : Show Sequence
    >NP_218137.1 ESAT-6 like protein EsxW [Mycobacterium tuberculosis H37Rv]
    MTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNM
    LHGVRDGLVRDANNYEQQEQASQQILSS
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : ID93/GLA-SE protects against TB and MDR-TB in animals.(Bertholet et al., 2010)
  • Related Vaccine(s): ID93/GLA-SE
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.296
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
9. FbpA (Ag85A)
  • Gene Name : FbpA (Ag85A)
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0010952
  • NCBI Gene ID : 886132
  • NCBI Protein GI : 15610940
  • Locus Tag : Rv3804c
  • Genbank Accession : AL123456
  • Protein Accession : NP_218321
  • 3D structure: PDB ID : 1SFR
  • Other Database IDs : EMBL: AE000516
    EMBL: BX842584
    EMBL: M27016
    EMBL: U47335
    GenomeReviews: AE000516_GR
    GenomeReviews: AL123456_GR
    InterPro: IPR000801
    KEGG: mtc:MT3911
    KEGG: mtu:Rv3804c
    PDB: 1SFR
    Pfam: PF00756
    PIR: H70887
    TIGR: MT3911
    TubercuList: Rv3804c
    UniProt: P0A4V2
  • Taxonomy ID : 83332
  • Gene Starting Position : 4265641
  • Gene Ending Position : 4266657
  • Gene Strand (Orientation) : -
  • Protein Name : diacylglycerol acyltransferase/mycolyltransferase Ag85A
  • Protein pI : 6.51
  • Protein Weight : 33304.71
  • Protein Length : 338
  • Protein Note : Rv3804c, (MT3911, MTV026.09c), len: 338 aa. fbpA (alternate gene names: mpt44, 85A), precursor of the 85-A antigen (fibronectin-binding protein A) (mycolyl transferase 85A) (EC 2.3.1.-) (see citations below), identical to P17944|P17996|FBPA|MPT44 ANTIGEN 85-A PRECURSOR from Mycobacterium bovis (338 aa), FASTA scores: opt: 2341, E(): 1.2e-132, (100.0% identity in 338 aa overlap); and highly similar to other Mycobacterial antigen precursors e.g. O52956|A85A_MYCAV|FBPA ANTIGEN 85-A PRECURSOR (85A) from Mycobacterium avium (347 aa), FASTA scores: opt: 1987, E(): 1.7e-111, (82.55% identity in 338 aa overlap); Q05861|A85A_MYCLE|FBPA|ML0097 ANTIGEN 85-A PRECURSOR (85A) from Mycobacterium leprae (330 aa), FASTA scores: opt: 1936, E(): 1.9e-108, (83.0% identity in 329 aa overlap); O06052|A85A_MYCGO|FBPA ANTIGEN 85-A PRECURSOR (85A) from Mycobacterium gordonae (339 aa), FASTA scores: opt: 1932, E(): 3.3e-108, (80.45% identity in 338 aa overlap); etc. Also highly similar to P31952|A85B_MYCTU|FBPB|Rv1886c|MT1934|MTCY180.32 SECRETED ANTIGEN 85-B from Mycobacterium tuberculosis (325 aa), FASTA scores: opt: 1830, E(): 3.9e-102, (78.85% identity in 317 aa overlap); P31953|A85C_MYCTU|FBPC|MPT45|Rv0129c|MTCI5.03c|FBPC2 SECRETED ANTIGEN 85-C from Mycobacterium tuberculosis (340 aa), FASTA scores: opt: 1597, E(): 3.4e-88, (67.25% identity in 336 aa overlap).; mpt44; 85A
  • Protein Annotation : FUNCTION: Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity (UniProt: P0A4V2)

    SUBCELLULAR LOCATION: Secreted protein (UniProt: P0A4V2)

    PTM: Contains one disulfide bridge (UniProt: P0A4V2)

    SIMILARITY: Belongs to the mycobacterial A85 antigen family (UniProt: P0A4V2)
  • DNA Sequence : Show Sequence
    >NC_000962.3:4265641-4266657 Mycobacterium tuberculosis H37Rv, complete genome
    GCTAGGCGCCCTGGGGCGCGGGCCCGGTGTTGGGCGTGGCACCCAGTGCCCGTTGCAGGTCGGGCTTCAT
    AGCGTTGAGCTGCGCGCCCCAGTACTCCCAGCTGTGCGTACCGCTGTCCGGGAAGTCGAACACGCCGTTG
    TGGCCGCCACCGGCGTTGTAGGCGTCTTGGAACTTGATGTTGCTGGTCCGCACGAAGCCCTCGAGGAACT
    TGGCCGGCAGGTTGTTGCCACCCAGATCCGACGGCTTGCCGTTGCCGCAGTACACCCAGACGCGGGTGTT
    GTTGGCGATCAGCTTCCCGACGTTCAACAGCGGGTCGTTGCGCTGCCACGCCGGGTCCTCCTTCGGGCCC
    CACATGTCGGAGGCCTTGTAGCCGCCAGCGTCACCCATCGCCAGGCCGATCAGGGTGGGACCCATCGCCT
    GGGAGGGGTCCAACAGGCCCGACATCGCTCCCGCGTAGACGAACTGCTGGGGGTGATAGATCGCCAGCGT
    CAGCGCCGAAGAAGCAGCCATCGAAAGACCGACGACGGCGCTTCCGGTGGGCTTGACGTGCCTGTTGGCC
    TGCAGCCACCCCGGCAGCTCGCTGGTCAGGAAGGTCTCCCACTTGTAAGTCTGGCAACCGGCCTTGCCGC
    AGGCGGGCTGGTACCAGTCGGAGTAGAAGCTTGACTGGCCACCCACCGGCATGACCACCGACAGGCCCGA
    CTGGTCGTACCACTCGAACGCCGGGGTGTTGATGTCCCAGCCGCTGAAGTCGTCCTGCGCGCGCAGGCCG
    TCGAGCAGGTACAGGGCGGGCGAGTTGGCACCACCACTTTGGAATTGGACCTTGATGTCACGGCCCATCG
    ACGGCGACGGCACCTGCAGGTACTCCACCGGCAAGCCCGGCCGGGAAAATGCCCCCGCGGTCGCCGTGCC
    ACCGACGGCGCCGACCAGACCCGACACTAGGGCCGCGCCGACGGCCCCGACCACGAGTCGACGCGACATA
    CCCGTGACGGCGCCACGAACCCTGTCAACAAGCTGCA
    
    
  • Protein Sequence : Show Sequence
    >NP_218321.1 diacylglycerol acyltransferase/mycolyltransferase Ag85A [Mycobacterium tuberculosis H37Rv]
    MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQ
    SGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKW
    ETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLA
    MGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSN
    IKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Researchers have developed DNA vaccines expressing M. tuberculosis antigen 85A (Ag85A, fbpA) and cytokine granulocyte macrophage colony stimulating factor (GM-CSF). The immune strategy of BCG-prime and DNA vaccine boost induced mice to generate efficient immune protection against M. tuberculosis challenge (Dou et al., 2010).
  • COG: COG0627R, under R: General function prediction only
  • Related Vaccine(s): DNA vaccine co-expressing A85A and caspase-3 , M. tuberculosis DNA vaccine DNAAg85A encoding a single immunogenic M.tb Ag , M. tuberculosis DNA vaccine pcDNA3.1+/Ag85A DNA encoding Ag85A , MVA/IL-15/5Mtb vaccine , MVA85A prime and BCG boost , rBCG-Ag85A/ Ag85B , rBCG-Ag85A[Tokyo]
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.770
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
10. FbpD
  • Gene Name : FbpD
  • Sequence Strain (Species/Organism) : Mycobacterium bovis BCG str. Tokyo 172
  • VO ID : VO_0012366
  • NCBI Gene ID : 7562680
  • NCBI Protein GI : 224992215
  • Locus Tag : JTY_3867
  • Genbank Accession : AP010918
  • Protein Accession : YP_002646905
  • 3D structure: PDB ID : 1R88
  • Taxonomy ID : 561275
  • Gene Starting Position : 4234158
  • Gene Ending Position : 4235057
  • Gene Strand (Orientation) : -
  • Protein Name : MPT51/MPB51 antigen protein
  • Protein pI : 6.63
  • Protein Weight : 29500.66
  • Protein Length : 299
  • DNA Sequence : Show Sequence
    >NC_012207.1:4234158-4235057 Mycobacterium bovis BCG str. Tokyo 172 DNA, complete genome
    CTTAGCGGATCGCACCGACGATATCGCCCGACATAGCGCCCAGCTGGGGCGCCCACGAGCCCCAGCCGTT
    GTCACCGCTGGCTGGGAAGTCGAAGTGTCCGTTGTGCCCGCCGACGCTGCGATACTGGTTGTAGAACATG
    CGGCTGTTACCCATCGCCTCGGCGGCTTGGCCGATCATGGCGGCGGGATCGCTGGCTCCCGGGTTGGTCG
    GGCTCCACACCCACACCCGGGTGTTGTTTTGCGCCAGCAGGCTGGCATGCACCCACGGGTCGTGCCACTT
    CCACCGACCCAGCTGTGGTGCTCCCCACATTCCGTTGGTGTCCACACCGCCGAATTGCTGCATGCCCGCC
    GCGATCGCACCGTTGGTGGTGGTGTTCGACGGGTACAAAAAGCCCGACATCGAGCCAGCGAAGCCGAAGC
    GGTCGGGGTGGAAGGCCGCCAGCGCCATCGCCCCGTAACCGCCCTGAGCGGCGCCAACGGCCGCATGGCC
    ACCGGGGGCCAAGCCCCGGTTAGCGGCCAGCCAGTCGGGCAGCTCAGCGGACAAGAAGGTGTCCCACTGC
    TTGCTGCCATCCTGCTCCCAGTTGGTGTACATGCTGTACGCACCACCGGCCGGTGCCACCACCGAAATCC
    CCTTGCCCGCCAACGTGTTCATCGCGTTACCCGCGGTGACCCAGTTACTGACATCCGGGCCGGCGTTGAA
    GGCGTCCAGCAGATACACCGCGTGCGGCCCACCGGCTAGGAAGGCCACCGGGATGTCCCGGCCCATCGAG
    GGCGACGGCACCATCAGGTTCTCGTATGGGGCGGCCTTGGCGGTGGGTTCCGCGGCTACCGCGACACCGC
    CCAACCCGAATGACAGTGCGGCAATCCAGAGCGCCCGCAGCAGCGCCGACCGACCCTTCA
    
    
  • Protein Sequence : Show Sequence
    >YP_002646905.1 MPT51/MPB51 antigen protein [Mycobacterium bovis BCG str. Tokyo 172]
    MKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNA
    GPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHA
    AVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWH
    DPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGW
    GSWAPQLGAMSGDIVGAIR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Intravenous vaccination with recombinant bacteria carrying expression plasmid for MPB/MPT51 in BALB/c mice elicited significant protective responses, comparable to those evoked by a live Mycobacterium bovis BCG vaccine (Miki et al., 2004).
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.747
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
11. HBHA
  • Gene Name : HBHA
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Ra
  • VO ID : VO_0012373
  • NCBI Gene ID : 5211814
  • NCBI Protein GI : 148660242
  • Locus Tag : MRA_0482
  • Genbank Accession : CP000611
  • Protein Accession : YP_001281765
  • Taxonomy ID : 25177
  • Gene Starting Position : 567106
  • Gene Ending Position : 567705
  • Gene Strand (Orientation) : +
  • Protein Name : iron-regulated heparin binding hemagglutinin Hbha
  • Protein pI : 9.84
  • Protein Weight : 20541.79
  • Protein Length : 199
  • DNA Sequence : Show Sequence
    >NC_009525.1:567106-567705 Mycobacterium tuberculosis H37Ra, complete genome
    CATGGCTGAAAACTCGAACATTGATGACATCAAGGCTCCGTTGCTTGCCGCGCTTGGAGCGGCCGACCTG
    GCCTTGGCCACTGTCAACGAGTTGATCACGAACCTGCGTGAGCGTGCGGAGGAGACTCGTACGGACACCC
    GCAGCCGGGTCGAGGAGAGCCGTGCTCGCCTGACCAAGCTGCAGGAAGATCTGCCCGAGCAGCTCACCGA
    GCTGCGTGAGAAGTTCACCGCCGAGGAGCTGCGTAAGGCCGCCGAGGGCTACCTCGAGGCCGCGACTAGC
    CGGTACAACGAGCTGGTCGAGCGCGGTGAGGCCGCTCTAGAGCGGCTGCGCAGCCAGCAGAGCTTCGAGG
    AAGTGTCGGCGCGCGCCGAAGGCTACGTGGACCAGGCGGTGGAGTTGACCCAGGAGGCGTTGGGTACGGT
    CGCATCGCAGACCCGCGCGGTCGGTGAGCGTGCCGCCAAGCTGGTCGGCATCGAGCTGCCTAAGAAGGCT
    GCTCCGGCCAAGAAGGCCGCTCCGGCCAAGAAGGCCGCTCCGGCCAAGAAGGCGGCGGCCAAGAAGGCGC
    CCGCGAAGAAGGCGGCGGCCAAGAAGGTCACCCAGAAGTA
    
    
  • Protein Sequence : Show Sequence
    >YP_001281765.1 iron-regulated heparin binding hemagglutinin Hbha [Mycobacterium tuberculosis H37Ra]
    MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKLQEDLPEQLTE
    LREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTV
    ASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Purified preparations of HBHA were emulsified in a dimethyldioctadecylammonium bromide-monophosphoryl lipid A adjuvant and tested for the ability to reduce M. tuberculosis infection in the mouse aerosol challenge model for tuberculosis. The HBHA-containing vaccine gave a approximately 0.7-log reduction in CFU in both mouse lungs and spleens compared to adjuvant controls 28 days following challenge (Parra et al., 2004).
  • Related Vaccine(s): M. tuberculosis HBHA Protein Vaccine
  • Localization(Probability): Cellwall
    (Prob.=1)
  • Adhesin Probability: 0.676
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
12. KatG
  • Gene Name : KatG
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012369
  • NCBI Gene ID : 885638
  • NCBI Protein GI : 15609045
  • Locus Tag : Rv1908c
  • Genbank Accession : AL123456
  • Protein Accession : NP_216424
  • 3D structure: PDB ID : 1SJ2
  • Taxonomy ID : 83332
  • Gene Starting Position : 2153888
  • Gene Ending Position : 2156110
  • Gene Strand (Orientation) : -
  • Protein Name : catalase-peroxidase
  • Protein pI : 4.87
  • Protein Weight : 75544.06
  • Protein Length : 740
  • Protein Note : Rv1908c, (MTCY180.10), len: 740 aa. katG, catalase-peroxidase-peroxynitritase T (EC 1.11.1.6) (see citations below), HPI. FASTA results: Q57215 CATALASE-PEROXIDASE from Mycobacterium tuberculosis (740 aa) opt: 5081, E(): 0, (100% identity in 740 aa overlap). Contains peroxidases active site signature (PS00436) and ATP/GTP-binding site motif A (P-loop; PS00017). Cosmid sequence was corrected to agree with a sequencing read from the H37Rv genome. DELETIONS OR DEFECTS IN KATG GENE CAUSE ISONIAZID (INH) RESISTANCE. BELONGS TO THE PEROXIDASE FAMILY. BACTERIAL PEROXIDASE/CATALASE SUBFAMILY. KATG TRANSCRIPTION SEEMS TO BE REGULATED BY FURA|Rv1909c PRODUCT. The catalase-peroxidase activity is associated with the amino-terminal domain but no definite function has been assigned to the carboxy-terminal domain. TBparse score is 0.923.
  • DNA Sequence : Show Sequence
    >NC_000962.3:2153888-2156110 Mycobacterium tuberculosis H37Rv, complete genome
    ATCAGCGCACGTCGAACCTGTCGAGGTTCATCACCTTGTCCCAGGCAGCGACGAAGTCCTGCACGAACTT
    CGGCTGCGCGTCATCGGCGCCATAGACCTCGACAAGCGCCCGCAACTCCGAGTTGGACCCGAAGACCAGG
    TCCACGCGGCTGCCGGTCCACTTCACCTTGCCACTGCCATCCTTGCCCTGGTAGGTCCCGTCATCTGCTG
    GCGAGGGCTCCCAGGTGATACCCATGTCGAGCAGGTTCACGAAGAAGTCGTTGGTCAGTGACTCGGAGGC
    CTCGGTGAACACGCCCAGCGGTAAGCGCTTGTAGTTTGCGCCGAGGACGCGCAGGCCACCTACCAGCACC
    GTCATCTCAGGGGCACTGAGCGTAAGCAGGTTCGCCTTGTCGAGCAGCATGTACTCGGCCGGCAACGGGT
    TGCCCTTTCCGAGGTAGTTTCGGAAGCCATCTGCCTTGGGCTCCAGCACGGCAAAGGATTCCACGTCGGT
    TTGTTCCTGCGACGCATCCGTGCGGCCCGGGGTGAAGGGCACCGTGATGTTGTGGCCAGCCGCCTTTGCT
    GCTTTCTCTATGGCGGCACAGCCACCGAGCACGACGAGGTCGGCGAAGGACACTTTGATGTTCCCCGGCG
    CCGCGGAGTTGAATGACTCCTGGATCTCTTCCAGGGTGCGAATGACCTTGCGCAGATCCCCGTCGGGGTC
    GTTGACCTCCCACCCGACTTGTGGCTGCAGGCGGATGCGACCACCGTTGGCGCCGCCGCGCTTGTCGCTA
    CCACGGAACGACGACGCCGCCGCCCATGCGGTCGAAACTAGCTGTGAGACAGTCAATCCCGATGCCCGGA
    TCTGGCTCTTAAGGCTGGCAATCTCGGCTTCGCCGACGAGGTCGTGGCTGACCGCAGGGACCGGATCCTG
    CCACAGCAGGGTCTGCTTGGGGACCAGCGGCCCAAGGTATCTCGCAACGGGACCCATGTCTCGGTGGATC
    AGCTTGTACCAGGCCTTGGCGAACTCGTCGGCCAATTCCTCGGGGTGTTCCAGCCAGCGACGCGTGATCC
    GCTCATAGATCGGATCCACCCGCAGCGAGAGGTCAGTGGCCAGCATCGTCGGGGAGCGCCCTGGCCCGCC
    GAACGGGTCCGGGATGGTGCCGGCACCGGCGCCGTCCTTGGCGGTGTATTGCCAAGCGCCAGCAGGGCTC
    TTCGTCAGCTCCCACTCGTAGCCGTACAGGATCTCGAGGAAACTGTTGTCCCATTTCGTCGGGGTGTTCG
    TCCATACGACCTCGATGCCGCTGGTGATCGCGTCCTTACCGGTTCCGGTGCCATACGAGCTCTTCCAGCC
    CAAGCCCATCTGCTCCAGCGGAGCAGCCTCGGGTTCGGGGCCGACCAGATCGGCCGGGCCGGCGCCATGG
    GTCTTACCGAAAGTGTGACCGCCGACGATCAGCGCCGCTGTTTCGACGTCGTTCATGGCCATGCGCCGAA
    ACGTCTCGCGAATGTCGACCGCCGCGGCCATGGGGTCCGGGTTGCCGTTCGGCCCCTCCGGGTTCACGTA
    GATCAGCCCCATCTGCACCGCGGCCAGCGGGTTCTCCAGATCCCGCTTACCGCTGTAACGCTCATCGCCG
    AGCCAGGTGGCTTCCTTGCCCCAATAGACCTCATCGGGCTCCCACTGGTCGACCCGGCCGAAGCCGAACC
    CGAACGTCTTGAAGCCCATCGATTCCAGCGCGCAGTTGCCGGCGAAAACAATCAGGTCCGCCCATGAGAG
    CTTCTTGCCGTACTTCTTCTTGACCGGCCACAGCAGCCGGCGCGCCTTGTCCAAGCTGGCGTTGTCGGGC
    CAGCTGTTAAGCGGCGCGAACCGCTGCATGCCGCCCCCGGCGCCGCCGCGGCCGTCGTGGATGCGGTAGG
    TGCCGGCAGCGTGCCACGCCATCCGGATAAACAGCGGCCCGTAGTGGCCGTAGTCGGCGGGCCACCACGG
    CTGCGAGGTGGTCATCACTTCCTCGATGTCCCGCGTCAGGGCGTCAACGTCGATGGTCGCGACCTCCGCG
    GCATAGTCGAACGCCGCACCCATCGGGTCAGCGACGGCCGGGTTTTGGTGCAGTACCTTCAGATTGAGCC
    GGTTGGGCCACCAGTCCTGGTTTCCGCCGCCCTCGACGGGGTATTTCATATGACCCACGACGGGACAGCC
    GTTGCTAGCGGCTCCGGTGGTGGTTTCTGTAATGGGTGGGTGTTGCTCGGGCA
    
    
  • Protein Sequence : Show Sequence
    >NP_216424.1 catalase-peroxidase [Mycobacterium tuberculosis H37Rv]
    MPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQNPAVADPMGAAFDYAAEVAT
    IDVDALTRDIEEVMTTSQPWWPADYGHYGPLFIRMAWHAAGTYRIHDGRGGAGGGMQRFAPLNSWPDNAS
    LDKARRLLWPVKKKYGKKLSWADLIVFAGNCALESMGFKTFGFGFGRVDQWEPDEVYWGKEATWLGDERY
    SGKRDLENPLAAVQMGLIYVNPEGPNGNPDPMAAAVDIRETFRRMAMNDVETAALIVGGHTFGKTHGAGP
    ADLVGPEPEAAPLEQMGLGWKSSYGTGTGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGA
    WQYTAKDGAGAGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEHPEELADEFAKAWYKLIHRDM
    GPVARYLGPLVPKQTLLWQDPVPAVSHDLVGEAEIASLKSQIRASGLTVSQLVSTAWAAASSFRGSDKRG
    GANGGRIRLQPQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSFADLVVLGGCAAIEKAAKAAG
    HNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGKGNPLPAEYMLLDKANLLTLSAPEMTVLVGG
    LRVLGANYKRLPLGVFTEASESLTNDFFVNLLDMGITWEPSPADDGTYQGKDGSGKVKWTGSRVDLVFGS
    NSELRALVEVYGADDAQPKFVQDFVAAWDKVMNLDRFDVR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : DNA vaccines encoding KatG antigen fused to TPA signal sequences evoked a significant protective response in mice aerogenically challenged with low doses of Mycobacterium tuberculosis Erdman 17 to 21 days after the final immunization (Li et al., 1999).
  • Related Vaccine(s): M. tuberculosis DNA vaccine (containing the ESAT-6, MPT-64, MPT-83, and KatG constructs) , M. tuberculosis DNA Vaccine encoding KatG
  • Localization(Probability): Cytoplasmic
    (Prob.=0.967)
  • Adhesin Probability: 0.267
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
13. Mpt63
  • Gene Name : Mpt63
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0011176
  • NCBI Gene ID : 885334
  • NCBI Protein GI : 15609063
  • Locus Tag : Rv1926c
  • Genbank Accession : AL123456
  • Protein Accession : NP_216442
  • 3D structure: PDB ID : 1LMI
  • Taxonomy ID : 83332
  • Gene Starting Position : 2178956
  • Gene Ending Position : 2179435
  • Gene Strand (Orientation) : -
  • Protein Name : immunogenic protein Mpt63
  • Protein pI : 4.67
  • Protein Weight : 14827.76
  • Protein Length : 159
  • Protein Note : Rv1926c, (MT1977, MTCY09F9.38), len: 159 aa. mpt63 (alternate gene name: mpb63), immunogenic protein (see citations below), identical to MPT63|MPB63 from Mycobacterium bovis (159 aa). Exported protein containing a N-terminal signal sequence: see notes below about proteomics.; mpb63
  • DNA Sequence : Show Sequence
    >NC_000962.3:2178956-2179435 Mycobacterium tuberculosis H37Rv, complete genome
    TCTACGGCTCCCAAATCAGCAGATCCTCCATGCCGTTGTTCATCGCGACGATGGTTGGCGATGGGCCGGT
    GACATCGAAGTAGATTTTGCCGGTCGATTGTTCGCCTTGGGGGATAGTGGCTCCGCTAATGGTGTCGGGG
    CCCGCGGCTTGCCACAGCACCCGGTAGTTGATGCCGTCGGCGGTGCGGGCATTGAACTGCGAGACCGCGG
    GCGTGACGCTGCCGCGAATCGCATTGACCGTGGCAGTGGCCTCCCAGACCTGGCCGGCCACCGGATAGCC
    GGGGATGACTGCCGTGCTGGATTTGAGATCACTGACCTTCCAGCCGAGCACGACTTGGCCAACGGTGTCG
    GTCATCGTTAGCTCACTGCCAAGTTTTCCGGTGATGGGATAGGCAGCCAACGCGACCGGTGCCGCAAAGG
    TCGCGATGGCCGCCATGGCCACGACCGCTACTGCCGTCTTGATCATTGTGGTGAGCTTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_216442.1 immunogenic protein Mpt63 [Mycobacterium tuberculosis H37Rv]
    MKLTTMIKTAVAVVAMAAIATFAAPVALAAYPITGKLGSELTMTDTVGQVVLGWKVSDLKSSTAVIPGYP
    VAGQVWEATATVNAIRGSVTPAVSQFNARTADGINYRVLWQAAGPDTISGATIPQGEQSTGKIYFDVTGP
    SPTIVAMNNGMEDLLIWEP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : MPT63 (Rv1926c), a major secreted protein of Mycobacterium tuberculosis, is immunoreactive in antibody assays in humans and animals and provides protection as a combined DNA vaccine in mice (Mustafa, 2009).
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.578
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
14. MPT64
  • Gene Name : MPT64
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012367
  • NCBI Gene ID : 885925
  • NCBI Protein GI : 15609117
  • Locus Tag : Rv1980c
  • Genbank Accession : A42312
  • Protein Accession : NP_216496
  • 3D structure: PDB ID : 2HHI
  • Taxonomy ID : 83332
  • Gene Starting Position : 2223342
  • Gene Ending Position : 2224028
  • Gene Strand (Orientation) : -
  • Protein Name : immunogenic protein Mpt64
  • Protein pI : 4.6
  • Protein Weight : 23267.4
  • Protein Length : 228
  • Protein Note : Rv1980c, (MT2032, MTCY39.39), len: 228 aa. mpt64 (alternate gene name: mpb64), immunogenic protein (alternate gene name: mpb64) (see citations below), identical to MPT64|MPB64 from Mycobacterium bovis (228 aa). Similar to Rv3036c|MTV012.51c from Mycobacterium tuberculosis. Exported protein containing a N-terminal signal sequence: see notes below about proteomics.; mpb64
  • DNA Sequence : Show Sequence
    >NC_000962.3:2223342-2224028 Mycobacterium tuberculosis H37Rv, complete genome
    TCTAGGCCAGCATCGAGTCGATCGCGGAACGTGGGACCAATACCTGGGTTGGGCCGGCTGCTTCGGGCAG
    CAACTCCCCCGGGTTGAAGAAGAAAATCACCCCGTCGTTCGTGACTGCGAAGTTCTGATAATTCACCGGG
    TCCAAGCCGGCATTCGGCGCTATCGATACCTGTTGTCCGGTCTGCTTGCTCAGTTCACCTTGCACAATGG
    GGAAGACGACTGGCAGCGGATCGGTGTCAGCCTGCCACAGCGTGTCATAGGTGATTGGCTTGCGATAGGC
    CTGGTCCCAATCGAAGGCCTTGTACGTGGTCGTTGGGTGCGTGCCGCCGGCGTTCTGGTAGACCTTGAGC
    ACCACGGCCTGCGTACCACGCGGCGGTATCGCGGACTGGTATGTGGCCGAGGTGATATTCAATTCGTAGG
    GGGCTTCGCGTGGAGTGGACGATGTGGCCGCGCTGAGGAACTTGTCGCGCGTCTGGGCGATGTAATTTTC
    CAGCGACTTCTGGTCGGGGTAGTAACTGGGCAGGCTGATGTTGATGTTGTAGGCCGGGTCGGACATTTGA
    ATCTGGCACGCCTGGCCGGTATCGGTGCCTTTCAACTCCTCGCAGTAGGTCTTGGGCGCGGCCGTGGCCA
    CACCCGAACAACAGAGCAAAACGACAGCCGTGACCAGCATGAAGATCTTGATGCGCA
    
    
  • Protein Sequence : Show Sequence
    >NP_216496.1 immunogenic protein Mpt64 [Mycobacterium tuberculosis H37Rv]
    MRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYI
    AQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRK
    PITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEA
    AGPTQVLVPRSAIDSMLA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : DNA vaccines encoding secreted proteins Ag85B and MPT64 protect mice from the tuberculosis H37Rv strain (Luo et al., 2004).
    *Note* MPT64 in combination with Ag85B was protective, DNA vaccine of just MPT64 was mildly protective in mice.
  • Related Vaccine(s): M. tuberculosis DNA vaccine (containing the ESAT-6, MPT-64, MPT-83, and KatG constructs) , M. tuberculosis DNA vaccine encoding Ag85B, MPT64 and MPT83
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.749
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
15. MPT83
  • Gene Name : MPT83
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012409
  • NCBI Gene ID : 887155
  • NCBI Protein GI : 15610010
  • Locus Tag : Rv2873
  • Genbank Accession : AL123456
  • Protein Accession : NP_217389
  • Taxonomy ID : 83332
  • Gene Starting Position : 3183904
  • Gene Ending Position : 3184566
  • Gene Strand (Orientation) : +
  • Protein Name : cell surface lipoprotein
  • Protein pI : 4.73
  • Protein Weight : 20581.44
  • Protein Length : 220
  • Protein Note : Rv2873, (MTCY274.04), len: 220 aa. mpt83 (alternate gene name: mpb83), cell surface lipoprotein (see citations below). Also similar to upstream ORF Q50769|MP70_MYCTU|MPT70|MPB70|Rv2875|MT2943|MTCY274.06 which is also known as MAJOR SECRETED IMMUNOGENIC PROTEIN MPT70 PRECURSOR from Mycobacterium tuberculosis (193 aa), FASTA scores: opt: 806, E(): 2.7e-38, (70.25% identity in 185 aa overlap). BELONGS TO THE MPT70 / MPT83 FAMILY. ATTACHED TO THE MEMBRANE BY A LIPID ANCHOR.; mpb83
  • DNA Sequence : Show Sequence
    >NC_000962.3:3183904-3184566 Mycobacterium tuberculosis H37Rv, complete genome
    GATGATCAACGTTCAGGCCAAACCGGCCGCAGCAGCGAGCCTCGCAGCCATCGCGATTGCGTTCTTAGCG
    GGTTGTTCGAGCACCAAACCCGTGTCGCAAGACACCAGCCCGAAACCGGCGACCAGCCCGGCGGCGCCCG
    TTACCACGGCGGCAATGGCTGACCCCGCAGCGGACCTGATTGGTCGTGGGTGCGCGCAATACGCGGCGCA
    AAATCCCACCGGTCCCGGATCGGTGGCCGGAATGGCGCAAGACCCGGTCGCTACCGCGGCTTCCAACAAC
    CCGATGCTCAGTACCCTGACCTCGGCTCTGTCGGGCAAGCTGAACCCGGATGTGAATCTGGTCGACACCC
    TCAACGGCGGCGAGTACACCGTTTTCGCCCCCACCAACGCCGCATTCGACAAGCTGCCGGCGGCCACTAT
    CGATCAACTCAAGACTGACGCCAAGCTGCTCAGCAGCATCCTGACCTACCACGTGATAGCCGGCCAGGCG
    AGTCCGAGCAGGATCGACGGCACCCATCAGACCCTGCAAGGTGCCGACCTGACGGTGATAGGCGCCCGCG
    ACGACCTCATGGTCAACAACGCCGGTTTGGTATGTGGCGGAGTTCACACCGCCAACGCGACGGTGTACAT
    GATCGATACGGTGCTGATGCCCCCGGCACAGTA
    
    
  • Protein Sequence : Show Sequence
    >NP_217389.1 cell surface lipoprotein [Mycobacterium tuberculosis H37Rv]
    MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLIGRGCAQYAAQ
    NPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGGEYTVFAPTNAAFDKLPAATI
    DQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADLTVIGARDDLMVNNAGLVCGGVHTANATVYM
    IDTVLMPPAQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A single DNA vaccine encoding the MPT-83 tuberculosis antigens evoked partial protection against an aerogenic challenge with M. tuberculosis Erdman in the mouse model of pulmonary tuberculosis (Morris et al., 2000).
  • Related Vaccine(s): M. tuberculosis DNA vaccine (containing the ESAT-6, MPT-64, MPT-83, and KatG constructs) , M. tuberculosis DNA vaccine encoding Ag85B, MPT64 and MPT83
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=1)
  • Adhesin Probability: 0.763
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
16. Mtb72F
  • Gene Name : Mtb72F
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis
  • VO ID : VO_0011173
  • NCBI Protein GI : 283801990
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein pI : 4.95
  • Protein Weight : 66088.21
  • Protein Length : 799
  • Protein Note : Description of Artificial Sequence:tri-fusion protein MTB72F (Ra12-TbH9-Ra35 or MTB32-MTB39 fusion)
  • Protein Sequence : Show Sequence
    >CBI85484.1 unnamed protein product [synthetic construct]
    MHHHHHHTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNGARVQR
    VVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLAEGPPAE
    FMVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSVVWGLTVGSWIGSSAGLMVAA
    ASPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEA
    EYGEMWAQDAAAMFGYAAATATATATLLPFEEAPEMTSAGGLLEQAAAVEEASDTAAANQLMNNVPQALQ
    QLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAARQAVQ
    TAAQNGVRAMSSLGSSLGSSGLGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAER
    GPGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGDIAPPALSQDRFADFPALPLDPSAMVAQ
    VGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVA
    VLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQ
    FDAAIQPGDSGGPVVNGLGQVVGMNTAAS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Our lead construct, Mtb72F, codes for a 72-kDa polyprotein genetically linked in tandem in the linear order Mtb32(C)-Mtb39-Mtb32(N). All forms of Mtb72F immunization tested resulted in the protection of C57BL/6 mice against aerosol challenge with a virulent strain of M. tuberculosis (Skeiky et al., 2004).
  • Related Vaccine(s): M. tuberculosis Mtb72F Protein Subunit Vaccine
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.718
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
17. PE20
  • Gene Name : PE20
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012371
  • NCBI Gene ID : 885537
  • NCBI Protein GI : 57116919
  • Locus Tag : Rv1806
  • Genbank Accession : JLDD01000021
  • Protein Accession : YP_177843
  • Taxonomy ID : 83332
  • Gene Starting Position : 2048071
  • Gene Ending Position : 2048370
  • Gene Strand (Orientation) : +
  • Protein Name : PE family protein PE20
  • Protein pI : 4.19
  • Protein Weight : 8927.3
  • Protein Length : 99
  • Protein Note : Rv1806, (MTV049.28), len: 99 aa. Member of the Mycobacterium tuberculosis PE family of gly-, ala-rich proteins (see citation below), most similar to Rv1788|MTV049.10|AL022021 (99 aa), FASTA scores: opt: 334, E(): 4.7 e-15, (59.8% identity in 97 aa overlap). TBparse score is 0.932.
  • DNA Sequence : Show Sequence
    >NC_000962.3:2048071-2048370 Mycobacterium tuberculosis H37Rv, complete genome
    CATGGCGTTTGTTCTTGTCTGTCCAGATGCGCTGGCCATCGCGGCCGGTCAGTTGCGCCATGTTGGATCG
    GTGATAGCCGCGCGGAATGCGGTCGCGGCACCGGCAACTGCCGAATTGGCCCCGGCGGCCGCTGACGAAG
    TATCAGCTTTGACTGCAACACAATTCAACTTCCATGCCGCCATGTACCAAGCGGTCGGCGCCCAGGCGAT
    CGCCATGAATGAGGCGTTCGTCGCGATGTTGGGCGCCAGCGCGGATTCTTACGCGGCTACCGAAGCCGCC
    AACATCATTGCTGTGAGCTA
    
    
  • Protein Sequence : Show Sequence
    >YP_177843.1 PE family protein PE20 [Mycobacterium tuberculosis H37Rv]
    MAFVLVCPDALAIAAGQLRHVGSVIAARNAVAAPATAELAPAAADEVSALTATQFNFHAAMYQAVGAQAI
    AMNEAFVAMLGASADSYAATEAANIIAVS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A selection of previously identified protective Mycobacterium tuberculosis DNA vaccines were re-formulated as proteins and administered with a Th1-inducing adjuvant to help stimulate the relevant immune responses necessary for protection. One candidate (Rv1806-1807) induced protection in the guinea pig aerosol infection model 30 days post-challenge on the basis of reducing the bacterial burden of M. tuberculosis in the lungs (Vipond et al., 2006).
  • Related Vaccine(s): DNA vaccine Rv1806-1807
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=0.955)
  • Adhesin Probability: 0.702
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
18. PepA
  • Gene Name : PepA
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0010953
  • NCBI Gene ID : 886924
  • NCBI Protein GI : 15607267
  • Locus Tag : Rv0125
  • Genbank Accession : CP003248
  • Protein Accession : NP_214639
  • Taxonomy ID : 83332
  • Gene Starting Position : 151147
  • Gene Ending Position : 152214
  • Gene Strand (Orientation) : +
  • Protein Name : serine protease PepA
  • Protein pI : 4.91
  • Protein Weight : 30958.56
  • Protein Length : 355
  • Protein Note : Rv0125, (MTCI418B.07, MTB32A), len: 355 aa. Probable pepA (alternate gene name: mtb32a), serine protease (EC 3.4.21.-) (see Skeiky et al., 1999), highly similar to other proteases e.g. HHOB_ECOLI|P31137 protease hhob precursor (355 aa), FASTA scores: opt: 400, E(): 3.8e-14, (32.4% identity in 346 aa overlap). Also similar to Q50320 34 kDa PROTEIN PRECURSOR from Mycobacterium tuberculosis (361 aa), FASTA scores: opt: 1689, E(): 0, (70.7% identity in 362 aa overlap). Contains PS00135 Serine proteases, trypsin family, serine active site. Has a putative signal sequence at the N-terminus. BELONGS TO THE SERINE PROTEASE FAMILY.; mtb32a
  • DNA Sequence : Show Sequence
    >NC_000962.3:151147-152214 Mycobacterium tuberculosis H37Rv, complete genome
    GATGAGCAATTCGCGCCGCCGCTCACTCAGGTGGTCATGGTTGCTGAGCGTGCTGGCTGCCGTCGGGCTG
    GGCCTGGCCACGGCGCCGGCCCAGGCGGCCCCGCCGGCCTTGTCGCAGGACCGGTTCGCCGACTTCCCCG
    CGCTGCCCCTCGACCCGTCCGCGATGGTCGCCCAAGTGGGGCCACAGGTGGTCAACATCAACACCAAACT
    GGGCTACAACAACGCCGTGGGCGCCGGGACCGGCATCGTCATCGATCCCAACGGTGTCGTGCTGACCAAC
    AACCACGTGATCGCGGGCGCCACCGACATCAATGCGTTCAGCGTCGGCTCCGGCCAAACCTACGGCGTCG
    ATGTGGTCGGGTATGACCGCACCCAGGATGTCGCGGTGCTGCAGCTGCGCGGTGCCGGTGGCCTGCCGTC
    GGCGGCGATCGGTGGCGGCGTCGCGGTTGGTGAGCCCGTCGTCGCGATGGGCAACAGCGGTGGGCAGGGC
    GGAACGCCCCGTGCGGTGCCTGGCAGGGTGGTCGCGCTCGGCCAAACCGTGCAGGCGTCGGATTCGCTGA
    CCGGTGCCGAAGAGACATTGAACGGGTTGATCCAGTTCGATGCCGCGATCCAGCCCGGTGATTCGGGCGG
    GCCCGTCGTCAACGGCCTAGGACAGGTGGTCGGTATGAACACGGCCGCGTCCGATAACTTCCAGCTGTCC
    CAGGGTGGGCAGGGATTCGCCATTCCGATCGGGCAGGCGATGGCGATCGCGGGCCAGATCCGATCGGGTG
    GGGGGTCACCCACCGTTCATATCGGGCCTACCGCCTTCCTCGGCTTGGGTGTTGTCGACAACAACGGCAA
    CGGCGCACGAGTCCAACGCGTGGTCGGGAGCGCTCCGGCGGCAAGTCTCGGCATCTCCACCGGCGACGTG
    ATCACCGCGGTCGACGGCGCTCCGATCAACTCGGCCACCGCGATGGCGGACGCGCTTAACGGGCATCATC
    CCGGTGACGTCATCTCGGTGACCTGGCAAACCAAGTCGGGCGGCACGCGTACAGGGAACGTGACATTGGC
    CGAGGGACCCCCGGCCTG
    
    
  • Protein Sequence : Show Sequence
    >NP_214639.1 serine protease PepA [Mycobacterium tuberculosis H37Rv]
    MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADFPALPLDPSAMVAQVGPQVVNINTKL
    GYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPS
    AAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGG
    PVVNGLGQVVGMNTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGN
    GARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLA
    EGPPA
    
    
  • Molecule Role : Protective antigen
  • COG: COG0265O, under O: Posttranslational modification, protein turnover, chaperones
  • Related Vaccine(s): Mtb72f fusion protein
  • Localization(Probability): Unknown
    (Prob.=0.333)
  • Adhesin Probability: 0.636
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
19. PPE14
  • Gene Name : PPE14
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012374
  • NCBI Gene ID : 885069
  • NCBI Protein GI : 57116795
  • Locus Tag : Rv0915c
  • Genbank Accession : AL123456
  • Protein Accession : YP_177765
  • Taxonomy ID : 83332
  • Gene Starting Position : 1020057
  • Gene Ending Position : 1021328
  • Gene Strand (Orientation) : -
  • Protein Name : PPE family protein PPE14
  • Protein pI : 4.31
  • Protein Weight : 39057.75
  • Protein Length : 423
  • Protein Note : Rv0915c, (MTCY21C12.09c), len: 423 aa. PPE14 (alternate gene name: MTB41). Member of the Mycobacterium tuberculosis PPE family (see citation below), highly similar to many e.g. Rv1807 from Mycobacterium tuberculosis (403 aa), FASTA scores: opt: 966, E(): 4.4e-30, (45.7% identity in 392 aa overlap); etc. Contains PS00626 Regulator of chromosome condensation (RCC1) signature 2.; MTB41
  • DNA Sequence : Show Sequence
    >NC_000962.3:1020057-1021328 Mycobacterium tuberculosis H37Rv, complete genome
    TTTACCGCGGGGGGTTTCCGGGCGGCGGCTGCTCTCTAATCACAACTACCGGGGGTTTGCGGCCGTCCTC
    TTGGCCGTCAGTGCTGGTGCCGCTACGGGTGCCGCCACCGCCCGTCGTGCCGCGTGCGGCCAGGCTCGCC
    AAAGCCATCCCGCTGAGCAGGCCTGCCGGCATCCCGTTTAGGGCCGTCGGGTCGGCGCCGGCGCTGGAGC
    TGAAGGTGGGTGTTGCCTGAACGGCGAGCTGGATCTCCGGGGCGGCCGTGGTCCAGCTGTGCGGCACCGA
    CAACGCTCCGACTAATGCTGCGTGGCCGACGCCCGCGGACACCGGCGCCGCGCCCCCGAAGGGGCCCCAG
    TGCGGCTCCGGCTCGTCGGTCGCCGAACTCAGTGGATGGCCCTGCGTCGGTCCCAGCCCGCCGGCGTTCC
    CGTATAGGCCGATGTGCCAGGGTCTGGCCGTGTTCGTGATCGCGAGCGCAATGCTGCCGGTCGCGATGGA
    TGCAATGTAGAGCGCGATCACGTCCAATTCCCCTATCGGGGTGGGGATCACTATCGGCTGAGCGGATCCG
    ACTTGCGGGTTGAGGGTCGACGCGATCCCCAACAGTCCCGATGTCAGCGGATCAGCGTTGGCGGCCAATG
    CGGACAGAATGTCGCTCAGGATCCCCGGGGGCAGCTGGGCCAGTGTCGCCTGTGCATCCGCAACGGCGCC
    CGCACCGGCGGCTTGGGTCGCCGCGGCTGCGGCCGCGGGCCCGGCCGGGCCGGTGCCTTGCACGGGTGGA
    GTGAACGGCGGCAACGCCGACGCGGCCGCAGATGCCCCCTCATAGCTGTACATCACGGCAGCGTCTTGGG
    CCCACATTTCGGCATACTCGGCCTGGGTAGCCGCGATCGCCGCACTGTTTTGCCCCAGAATGTTCGCCGC
    GACCAGCGACATCAACCGGCTGCGGTTGGCCGCGACGAGGGATGGTGGCACCGTCATCGCGAACGCCGTC
    CCAAACGCTTCCGCCGCTGCCCTCGCCTGTGTGGCCGTCTCCTTCGCCAGCGCCGCCGTGGCGGCCAGCC
    ACCCCACATACGGCGTTGCCGCGGCCGCCATCGCGGCCGCCGCCGGCCCCATCCACGGCTCAACGATCAG
    CGTCGACACCACCGATCCATACGAGACCGCGGCGGAAGTCAACTCCGCGGCCACACCGTCCCAGGCGGCC
    GCGGCGGCTAGCATCGACTCCGGCCCCGGACCGGAATACATTCGGCTTGAATTCACTTCCGGAGGTAAAA
    GCCCGAAATCCA
    
    
  • Protein Sequence : Show Sequence
    >YP_177765.1 PPE family protein PPE14 [Mycobacterium tuberculosis H37Rv]
    MDFGLLPPEVNSSRMYSGPGPESMLAAAAAWDGVAAELTSAAVSYGSVVSTLIVEPWMGPAAAAMAAAAT
    PYVGWLAATAALAKETATQARAAAEAFGTAFAMTVPPSLVAANRSRLMSLVAANILGQNSAAIAATQAEY
    AEMWAQDAAVMYSYEGASAAASALPPFTPPVQGTGPAGPAAAAAATQAAGAGAVADAQATLAQLPPGILS
    DILSALAANADPLTSGLLGIASTLNPQVGSAQPIVIPTPIGELDVIALYIASIATGSIALAITNTARPWH
    IGLYGNAGGLGPTQGHPLSSATDEPEPHWGPFGGAAPVSAGVGHAALVGALSVPHSWTTAAPEIQLAVQA
    TPTFSSSAGADPTALNGMPAGLLSGMALASLAARGTTGGGGTRSGTSTDGQEDGRKPPVVVIREQPPPGN
    PPR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : immunization with the soluble recombinant rMTB41 protein plus adjuvant, a regimen known to generate primarily CD4+ T cells, resulted in induction of protection comparable to BCG in two well-established animal models of tuberculosis (mice and guinea pigs) (Skeiky et al., 2005).
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=1)
  • Adhesin Probability: 0.592
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
20. PPE18
  • Gene Name : PPE18
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0010954
  • NCBI Gene ID : 886073
  • NCBI Protein GI : 57116841
  • Locus Tag : Rv1196
  • Genbank Accession : AL123456
  • Protein Accession : YP_177795
  • Taxonomy ID : 83332
  • Gene Starting Position : 1339348
  • Gene Ending Position : 1340523
  • Gene Strand (Orientation) : +
  • Protein Name : PPE family protein PPE18
  • Protein pI : 4.81
  • Protein Weight : 36280.96
  • Protein Length : 391
  • Protein Note : Rv1196, (MTCI364.08), len: 391 aa. PPE18 (alternate gene name: mtb39a). Member of the Mycobacterium tuberculosis PPE family of glycine-rich proteins, highly similar to others e.g. Y07P_MYCTU|Q11031 hypothetical 40.0 kDa protein cy02b10.25c (396 aa), FASTA scores: opt: 2124, E(): 0, (85.1% identity in 397 aa overlap). Note that expression of Rv1196 was demonstrated in lysates by immunodetection (see Dillon et al., 1999).; mtb39a
  • DNA Sequence : Show Sequence
    >NC_000962.3:1339348-1340523 Mycobacterium tuberculosis H37Rv, complete genome
    AATGGTGGATTTCGGGGCGTTACCACCGGAGATCAACTCCGCGAGGATGTACGCCGGCCCGGGTTCGGCC
    TCGCTGGTGGCCGCGGCTCAGATGTGGGACAGCGTGGCGAGTGACCTGTTTTCGGCCGCGTCGGCGTTTC
    AGTCGGTGGTCTGGGGTCTGACGGTGGGGTCGTGGATAGGTTCGTCGGCGGGTCTGATGGTGGCGGCGGC
    CTCGCCGTATGTGGCGTGGATGAGCGTCACCGCGGGGCAGGCCGAGCTGACCGCCGCCCAGGTCCGGGTT
    GCTGCGGCGGCCTACGAGACGGCGTATGGGCTGACGGTGCCCCCGCCGGTGATCGCCGAGAACCGTGCTG
    AACTGATGATTCTGATAGCGACCAACCTCTTGGGGCAAAACACCCCGGCGATCGCGGTCAACGAGGCCGA
    ATACGGCGAGATGTGGGCCCAAGACGCCGCCGCGATGTTTGGCTACGCCGCGGCGACGGCGACGGCGACG
    GCGACGTTGCTGCCGTTCGAGGAGGCGCCGGAGATGACCAGCGCGGGTGGGCTCCTCGAGCAGGCCGCCG
    CGGTCGAGGAGGCCTCCGACACCGCCGCGGCGAACCAGTTGATGAACAATGTGCCCCAGGCGCTGCAACA
    GCTGGCCCAGCCCACGCAGGGCACCACGCCTTCTTCCAAGCTGGGTGGCCTGTGGAAGACGGTCTCGCCG
    CATCGGTCGCCGATCAGCAACATGGTGTCGATGGCCAACAACCACATGTCGATGACCAACTCGGGTGTGT
    CGATGACCAACACCTTGAGCTCGATGTTGAAGGGCTTTGCTCCGGCGGCGGCCGCCCAGGCCGTGCAAAC
    CGCGGCGCAAAACGGGGTCCGGGCGATGAGCTCGCTGGGCAGCTCGCTGGGTTCTTCGGGTCTGGGCGGT
    GGGGTGGCCGCCAACTTGGGTCGGGCGGCCTCGGTCGGTTCGTTGTCGGTGCCGCAGGCCTGGGCCGCGG
    CCAACCAGGCAGTCACCCCGGCGGCGCGGGCGCTGCCGCTGACCAGCCTGACCAGCGCCGCGGAAAGAGG
    GCCCGGGCAGATGCTGGGCGGGCTGCCGGTGGGGCAGATGGGCGCCAGGGCCGGTGGTGGGCTCAGTGGT
    GTGCTGCGTGTTCCGCCGCGACCCTATGTGATGCCGCATTCTCCGGCGGCCGGCTA
    
    
  • Protein Sequence : Show Sequence
    >YP_177795.1 PPE family protein PPE18 [Mycobacterium tuberculosis H37Rv]
    MVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSVVWGLTVGSWIGSSAGLMVAAA
    SPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAE
    YGEMWAQDAAAMFGYAAATATATATLLPFEEAPEMTSAGGLLEQAAAVEEASDTAAANQLMNNVPQALQQ
    LAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQT
    AAQNGVRAMSSLGSSLGSSGLGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERG
    PGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAG
    
    
  • Molecule Role : Protective antigen
  • COG: COG5651N, under N: Cell motility
  • Related Vaccine(s): Mtb72f fusion protein
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=1)
  • Adhesin Probability: 0.830
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
21. PPE31
  • Gene Name : PPE31
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012372
  • NCBI Gene ID : 885072
  • NCBI Protein GI : WP_003409179
  • Locus Tag : Rv1807
  • Genbank Accession : AL123456
  • Protein Accession : YP_177653
  • Other Database IDs : CDD:227938
  • Taxonomy ID : 1763
  • Gene Starting Position : 2048397
  • Gene Ending Position : 2049596
  • Gene Strand (Orientation) : +
  • Protein Name : PPE family protein
  • Protein pI : 4.1
  • Protein Weight : 39253.11
  • Protein Length : 475
  • Protein Note : PPE-repeat protein [Function unknown]
  • DNA Sequence : Show Sequence
    >NC_000962.3:2048397-2049596 Mycobacterium tuberculosis H37Rv, complete genome
    ACTTGACTTCGCCACGCTACCGCCCGAAATCAACTCGGCGCGTATGTATTCCGGCGCGGGCTCGGCCCCG
    ATGCTGGCCGCAGCGTCAGCCTGGCACGGCTTGTCCGCAGAACTGCGCGCCAGCGCACTGTCATACAGCT
    CGGTGCTTTCGACGCTGACCGGTGAAGAATGGCACGGTCCGGCGTCGGCATCGATGACAGCCGCGGCCGC
    CCCCTACGTGGCCTGGATGAGCGTCACCGCCGTCCGGGCCGAGCAGGCCGGGGCACAGGCGGAGGCTGCC
    GCTGCAGCGTACGAAGCCGCGTTCGCAGCAACGGTGCCCCCGCCGGTCATCGAGGCCAACCGCGCCCAGC
    TCATGGCGCTGATCGCCACCAATGTGCTAGGCCAAAACGCCCCCGCGATCGCGGCCACCGAGGCCCAGTA
    CGCCGAAATGTGGTCCCAGGACGCGATGGCCATGTACGGCTACGCCGGCGCCTCGGCAGCCGCTACCCAG
    CTGACCCCGTTCACCGAGCCGGTGCAGACTACCAACGCGTCCGGCCTGGCGGCCCAGTCGGCTGCGATTG
    CCCACGCCACCGGCGCCTCGGCTGGTGCTCAGCAAACGACGCTGTCGCAGCTGATCGCCGCCATACCGTC
    TGTACTGCAAGGACTTTCGTCATCGACTGCAGCCACGTTCGCGTCGGGGCCGTCCGGATTGCTGGGCATT
    GTCGGGTCTGGATCTTCCTGGCTCGACAAACTCTGGGCGTTACTGGACCCCAACTCCAATTTCTGGAACA
    CGATAGCTTCGTCCGGACTGTTCTTGCCGAGTAACACGATTGCGCCCTTTTTGGGTCTACTCGGCGGCGT
    GGCAGCTGCGGATGCGGCCGGGGATGTGTTGGGAGAGGCCACCAGTGGCGGGCTCGGTGGCGCGCTGGTG
    GCGCCGCTTGGCTCAGCGGGCGGGCTAGGCGGCACTGTCGCGGCCGGCCTGGGCAACGCGGCCACCGTCG
    GAACCTTGTCGGTGCCGCCGAGCTGGACGGCGGCCGCACCACTAGCCAGCCCCTTGGGCTCCGCGTTGGG
    AGGCACACCGATGGTGGCACCGCCCCCAGCAGTGGCGGCCGGCATGCCCGGAATGCCTTTCGGCACCATG
    GGCGGTCAAGGCTTCGGGCGTGCCGTGCCCCAGTATGGCTTCCGCCCCAACTTCGTCGCACGACCGCCCG
    CCGCCGGGTG
  • Protein Sequence : Show Sequence
    >WP_003409179.1 MULTISPECIES: PPE family protein [Mycobacterium]
    MTAALDFATLPPEINSARMYSGAGSAPMLAAASAWHGLSAELRASALSYSSVLSTLTGEEWHGPASASMT
    AAAAPYVAWMSVTAVRAEQAGAQAEAAAAAYEAAFAATVPPPVIEANRAQLMALIATNVLGQNAPAIAAT
    EAQYAEMWSQDAMAMYGYAGASAAATQLTPFTEPVQTTNASGLAAQSAAIAHATGASAGAQQTTLSQLIA
    AIPSVLQGLSSSTAATSASGPSGLLGILGSGSSWLDKLWALLDPNSNFWNTIASSGLFLPSNTIAPFLGL
    LGGVAAADAAGDVLGEATSGGLGGALVAPLGSAGGLGGTVAAGLGNAATVGTLSVPPSWTAAAPLASPLG
    SALGGTPMVAPPPAVAAGMPGMPFGTMGGQGFGRAVPQYGFRPNFVARPPAAG
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A selection of previously identified protective Mycobacterium tuberculosis DNA vaccines were re-formulated as proteins and administered with a Th1-inducing adjuvant to help stimulate the relevant immune responses necessary for protection. One candidate (Rv1806-1807) induced protection in the guinea pig aerosol infection model 30 days post-challenge on the basis of reducing the bacterial burden of M. tuberculosis in the lungs (Vipond et al., 2006).
  • Related Vaccine(s): DNA vaccine Rv1806-1807
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=1)
  • Adhesin Probability: 0.867
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
22. PPE42
  • Gene Name : PPE42
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • NCBI Protein GI : YP_177893
  • Other Database IDs : CDD:307116
    CDD:279771
    CDD:311933
  • Taxonomy ID : 83332
  • Gene Strand (Orientation) : ?
  • Protein Name : PPE family protein PPE42
  • Protein pI : 4.26
  • Protein Weight : 57135.65
  • Protein Length : 663
  • Protein Note : PPE family; pfam00823
  • Protein Sequence : Show Sequence
    >YP_177893.1 PPE family protein PPE42 [Mycobacterium tuberculosis H37Rv]
    MNFAVLPPEVNSARIFAGAGLGPMLAAASAWDGLAEELHAAAGSFASVTTGLAGDAWHGPASLAMTRAAS
    PYVGWLNTAAGQAAQAAGQARLAASAFEATLAATVSPAMVAANRTRLASLVAANLLGQNAPAIAAAEAEY
    EQIWAQDVAAMFGYHSAASAVATQLAPIQEGLQQQLQNVLAQLASGNLGSGNVGVGNIGNDNIGNANIGF
    GNRGDANIGIGNIGDRNLGIGNTGNWNIGIGITGNGQIGFGKPANPDVLVVGNGGPGVTALVMGGTDSLL
    PLPNIPLLEYAARFITPVHPGYTATFLETPSQFFPFTGLNSLTYDVSVAQGVTNLHTAIMAQLAAGNEVV
    VFGTSQSATIATFEMRYLQSLPAHLRPGLDELSFTLTGNPNRPDGGILTRFGFSIPQLGFTLSGATPADA
    YPTVDYAFQYDGVNDFPKYPLNVFATANAIAGILFLHSGLIALPPDLASGVVQPVSSPDVLTTYILLPSQ
    DLPLLVPLRAIPLLGNPLADLIQPDLRVLVELGYDRTAHQDVPSPFGLFPDVDWAEVAADLQQGAVQGVN
    DALSGLGLPPPWQPALPRLF
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : ID93/GLA-SE protects against TB and MDR-TB in animals.
  • Related Vaccine(s): ID93/GLA-SE
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.592
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
23. PstS1
  • Gene Name : PstS1
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012407
  • NCBI Gene ID : 885724
  • NCBI Protein GI : 57116801
  • Locus Tag : Rv0934
  • Genbank Accession : AL123456
  • Protein Accession : YP_177770
  • 3D structure: PDB ID : 1PC3
  • Taxonomy ID : 83332
  • Gene Starting Position : 1042114
  • Gene Ending Position : 1043238
  • Gene Strand (Orientation) : +
  • Protein Name : phosphate ABC transporter substrate-binding lipoprotein PstS
  • Protein pI : 5.02
  • Protein Weight : 36356.95
  • Protein Length : 374
  • Protein Note : Rv0934, (MTCY08D9.05c), len: 374 aa. pstS1 (previously known as phoS1 or phoS), phosphate-binding lipoprotein component of inorganic phosphate transport system (see citations below), highly similar to Rv0932c|MTCY08D9.07|pstS2 PHOSPHATE-BINDING PERIPLASMIC LIPOPROTEIN from Mycobacterium tuberculosis (370 aa), FASTA scores: opt: 460, E(): 5.9e-19, (31.2% identity in 375 aa overlap); and Rv0928|MTCY21C12.22|pstS3 PHOSPHATE-BINDING PERIPLASMIC LIPOPROTEIN from Mycobacterium tuberculosis (374 aa), FASTA scores: opt: 435, E():1.1e-17, (30.0% identity in 380 aa overlap) (Mycobacterium tuberculosis seems to have three PstS-like proteins, others being Rv0932c and Rv0928c). Also highly similar to MTCY08D9.05c|P15712|PAB_MYCTU PROTEIN ANTIGEN B PRECURSOR from Mycobacterium tuberculosis (374 aa), FASTA scores: opt: 2459, E(): 0, (100% identity in 374 aa overlap). Contains a prokaryotic membrane lipoprotein lipid attachment site (PS00013) at the N-terminus so the 23 aa leader peptide sequence is probably removed. BELONGS TO FAMILY OF PHOSPHATE RECEPTORS FOR BACTERIAL ABC-TYPE LIPOPROTEIN TRANSPORTERS.; phoS1; phoS
  • DNA Sequence : Show Sequence
    >NC_000962.3:1042114-1043238 Mycobacterium tuberculosis H37Rv, complete genome
    CGTGAAAATTCGTTTGCATACGCTGTTGGCCGTGTTGACCGCTGCGCCGCTGCTGCTAGCAGCGGCGGGC
    TGTGGCTCGAAACCACCGAGCGGTTCGCCTGAAACGGGCGCCGGCGCCGGTACTGTCGCGACTACCCCCG
    CGTCGTCGCCGGTGACGTTGGCGGAGACCGGTAGCACGCTGCTCTACCCGCTGTTCAACCTGTGGGGTCC
    GGCCTTTCACGAGAGGTATCCGAACGTCACGATCACCGCTCAGGGCACCGGTTCTGGTGCCGGGATCGCG
    CAGGCCGCCGCCGGGACGGTCAACATTGGGGCCTCCGACGCCTATCTGTCGGAAGGTGATATGGCCGCGC
    ACAAGGGGCTGATGAACATCGCGCTAGCCATCTCCGCTCAGCAGGTCAACTACAACCTGCCCGGAGTGAG
    CGAGCACCTCAAGCTGAACGGAAAAGTCCTGGCGGCCATGTACCAGGGCACCATCAAAACCTGGGACGAC
    CCGCAGATCGCTGCGCTCAACCCCGGCGTGAACCTGCCCGGCACCGCGGTAGTTCCGCTGCACCGCTCCG
    ACGGGTCCGGTGACACCTTCTTGTTCACCCAGTACCTGTCCAAGCAAGATCCCGAGGGCTGGGGCAAGTC
    GCCCGGCTTCGGCACCACCGTCGACTTCCCGGCGGTGCCGGGTGCGCTGGGTGAGAACGGCAACGGCGGC
    ATGGTGACCGGTTGCGCCGAGACACCGGGCTGCGTGGCCTATATCGGCATCAGCTTCCTCGACCAGGCCA
    GTCAACGGGGACTCGGCGAGGCCCAACTAGGCAATAGCTCTGGCAATTTCTTGTTGCCCGACGCGCAAAG
    CATTCAGGCCGCGGCGGCTGGCTTCGCATCGAAAACCCCGGCGAACCAGGCGATTTCGATGATCGACGGG
    CCCGCCCCGGACGGCTACCCGATCATCAACTACGAGTACGCCATCGTCAACAACCGGCAAAAGGACGCCG
    CCACCGCGCAGACCTTGCAGGCATTTCTGCACTGGGCGATCACCGACGGCAACAAGGCCTCGTTCCTCGA
    CCAGGTTCATTTCCAGCCGCTGCCGCCCGCGGTGGTGAAGTTGTCTGACGCGTTGATCGCGACGATTTCC
    AGCTA
    
    
  • Protein Sequence : Show Sequence
    >YP_177770.1 phosphate ABC transporter substrate-binding lipoprotein PstS [Mycobacterium tuberculosis H37Rv]
    MKIRLHTLLAVLTAAPLLLAAAGCGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGP
    AFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVS
    EHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKS
    PGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQS
    IQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLD
    QVHFQPLPPAVVKLSDALIATISS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Vaccination with the recombinant PstS-1 antigen and cholera toxin significantly protected against the challenge given 10 days later, but only marginally after 12 weeks (Falero-Diaz et al., 2000).
  • Localization(Probability): Unknown
    (Prob.=0.333)
  • Adhesin Probability: 0.758
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
24. PstS3
  • Gene Name : PstS3
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • VO ID : VO_0012370
  • NCBI Gene ID : 885366
  • NCBI Protein GI : 57116798
  • Locus Tag : Rv0928
  • Genbank Accession : AL123456
  • Protein Accession : YP_177768
  • Taxonomy ID : 83332
  • Gene Starting Position : 1034902
  • Gene Ending Position : 1036014
  • Gene Strand (Orientation) : +
  • Protein Name : phosphate ABC transporter substrate-binding lipoprotein PstS
  • Protein pI : 5.85
  • Protein Weight : 35472.01
  • Protein Length : 370
  • Protein Note : Rv0928, (MTCY21C12.22), len: 370 aa. pstS3 (previously known as phoS2), phosphate-binding lipoprotein component of inorganic phosphate transport system (see citations below), highly similar to others from Mycobacterium leprae e.g. Q50099|PSTS3|PHOS1 phosphate-binding protein 3 precursor (328 aa), FASTA scores: opt: 1772, E(): 0, (79.6% identity in 328 aa overlap); and highly similar to others e.g. AAF74819.1|AF137360_1|AF137360 periplasmic phosphate permease from Mycobacterium avium (369 aa). Also highly similar to Rv0932c|MTCY08D9.07|pstS2 PHOSPHATE-BINDING PERIPLASMIC LIPOPROTEIN (370 aa); and Rv0934|pstS1 PHOSPHATE-BINDING PERIPLASMIC LIPOPROTEIN (374 aa) from Mycobacterium tuberculosis (Mycobacterium tuberculosis seems to have three PstS-like proteins, others being Rv0932c and Rv0934c). Contains lipoprotein signature (PS00013) at N-terminus. BELONGS TO FAMILY OF PHOSPHATE RECEPTORS FOR BACTERIAL ABC-TYPE LIPOPROTEIN TRANSPORTERS.; phoS2
  • DNA Sequence : Show Sequence
    >NC_000962.3:1034902-1036014 Mycobacterium tuberculosis H37Rv, complete genome
    ATTGAAACTCAACCGATTTGGTGCCGCCGTAGGTGTCCTGGCTGCGGGTGCGCTGGTGTTGTCCGCGTGT
    GGTAACGACGACAATGTGACCGGGGGAGGTGCAACCACTGGCCAGGCGTCGGCGAAGGTCGATTGCGGGG
    GGAAGAAGACACTCAAAGCCAGTGGGTCGACGGCGCAGGCCAACGCGATGACCCGCTTTGTCAACGTGTT
    CGAGCAGGCCTGCCCCGGCCAAACCCTGAACTACACGGCCAATGGTTCGGGCGCTGGAATCAGCGAATTT
    AATGGCAACCAAACCGATTTCGGTGGCTCAGATGTACCCCTGAGCAAGGACGAGGCCGCAGCGGCGCAGC
    GGCGTTGCGGCTCGCCGGCGTGGAATCTGCCGGTGGTGTTCGGCCCGATCGCGGTTACCTACAACCTCAA
    CAGCGTTTCCTCGCTAAATTTGGACGGCCCCACGTTGGCGAAGATCTTCAACGGCTCCATTACGCAGTGG
    AACAATCCCGCGATCCAGGCGCTGAACCGCGACTTCACGCTGCCAGGTGAGCGGATTCACGTGGTGTTCC
    GCAGCGATGAGTCGGGGACCACGGACAACTTCCAGAGGTACCTGCAGGCCGCGTCCAACGGTGCGTGGGG
    TAAGGGCGCTGGAAAGTCGTTCCAAGGCGGCGTCGGTGAGGGCGCGCGGGGTAACGATGGCACGTCAGCG
    GCCGCGAAGAACACCCCGGGGTCGATCACCTACAACGAGTGGTCGTTCGCCCAGGCGCAGCACCTGACCA
    TGGCCAACATCGTCACTTCGGCTGGTGGGGACCCGGTGGCGATTACTATCGACTCGGTCGGCCAGACGAT
    CGCCGGGGCCACCATCTCCGGGGTGGGCAACGACCTGGTGCTCGACACGGACTCGTTCTACCGGCCGAAG
    CGTCCCGGCTCCTATCCGATCGTGTTAGCGACATACGAAATCGTTTGCTCGAAGTATCCCGACTCGCAGG
    TTGGCACGGCTGTGAAGGCGTTCCTGCAGAGCACTATCGGCGCCGGTCAAAGCGGCCTGGGGGACAACGG
    ATACATCCCAATTCCGGACGAGTTCAAATCGAGGCTGTCGACTGCGGTCAACGCGATCGCCTG
    
    
  • Protein Sequence : Show Sequence
    >YP_177768.1 phosphate ABC transporter substrate-binding lipoprotein PstS [Mycobacterium tuberculosis H37Rv]
    MKLNRFGAAVGVLAAGALVLSACGNDDNVTGGGATTGQASAKVDCGGKKTLKASGSTAQANAMTRFVNVF
    EQACPGQTLNYTANGSGAGISEFNGNQTDFGGSDVPLSKDEAAAAQRRCGSPAWNLPVVFGPIAVTYNLN
    SVSSLNLDGPTLAKIFNGSITQWNNPAIQALNRDFTLPGERIHVVFRSDESGTTDNFQRYLQAASNGAWG
    KGAGKSFQGGVGEGARGNDGTSAAAKNTPGSITYNEWSFAQAQHLTMANIVTSAGGDPVAITIDSVGQTI
    AGATISGVGNDLVLDTDSFYRPKRPGSYPIVLATYEIVCSKYPDSQVGTAVKAFLQSTIGAGQSGLGDNG
    YIPIPDEFKSRLSTAVNAIA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice vaccinated with PstS-3 DNA demonstrated significant and sustained reduction in bacterial CFU numbers in spleen and lungs for 3 mo after M. tuberculosis challenge, as compared with CFU counts in mice vaccinated with control DNA (Tanghe et al., 1999).
  • Localization(Probability): Unknown
    (Prob.=0.333)
  • Adhesin Probability: 0.818
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
25. Rv1813c
  • Gene Name : Rv1813c
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • NCBI Protein GI : NP_216329
  • Other Database IDs : CDD:316353
  • Taxonomy ID : 83332
  • Gene Strand (Orientation) : ?
  • Protein Name : hypothetical protein
  • Protein pI : 10.16
  • Protein Weight : 14879.86
  • Protein Length : 224
  • Protein Note : Domain of unknown function (DUF4189); pfam13827
  • Protein Sequence : Show Sequence
    >NP_216329.1 hypothetical protein Rv1813c [Mycobacterium tuberculosis H37Rv]
    MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGLPIPPIIHYGAIAYAPSGASG
    KAWHQRTPARAEQVALEKCGDKTCKVVSRFTRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGRIVNW
    ACN
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : ID93/GLA-SE protects against TB and MDR-TB in animals.(Bertholet et al., 2010)
  • Related Vaccine(s): ID93/GLA-SE
  • Localization(Probability): Unknown
    (Prob.=0.333)
  • Adhesin Probability: 0.288
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
26. Rv2660c
  • Gene Name : Rv2660c
  • Sequence Strain (Species/Organism) : Mycobacterium tuberculosis H37Rv
  • NCBI Gene ID : 887222
  • NCBI Protein GI : 15609797
  • Locus Tag : Rv2660c
  • Genbank Accession : CP009480
  • Protein Accession : NP_217176
  • Taxonomy ID : 83332
  • Gene Starting Position : 2980962
  • Gene Ending Position : 2981189
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 4.63
  • Protein Weight : 6788.85
  • Protein Length : 75
  • Protein Note : Rv2660c, (MTCY441.29c), len: 75 aa (questionable orf). Hypothetical unknown protein.
  • DNA Sequence : Show Sequence
    >NC_000962.3:2980962-2981189 Mycobacterium tuberculosis H37Rv, complete genome
    ACTAGTGAAACTGGTTCAATCCCAGTATCGCGCACCACGATTGACCTGCGGTTTCATCCACAAAATCTGG
    GCTGCGTGAACTAAATGTGAACTGACTCGGTGCAACCACCGAAAGGTTCCTCTGTTCCGTGCCCACGCCG
    ACACCGACGGTGACCCCACCAGATGCGCCTGCCGCCCGCTGGCTAGCCTGGCCTGTTGCTGCAAGCGCCT
    GGTCGACGCCCGCTATCA
    
    
  • Protein Sequence : Show Sequence
    >NP_217176.1 hypothetical protein Rv2660c [Mycobacterium tuberculosis H37Rv]
    MIAGVDQALAATGQASQRAAGASGGVTVGVGVGTEQRNLSVVAPSQFTFSSRSPDFVDETAGQSWCAILG
    LNQFH
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : When combined with AG85B and ESAT-6, Rv2660c provided mice protection against challenge (Aagaard et al., 2011).
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.589
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
II. References
1. Aagaard et al., 2011: Aagaard C, Hoang T, Dietrich J, Cardona PJ, Izzo A, Dolganov G, Schoolnik GK, Cassidy JP, Billeskov R, Andersen P. A multistage tuberculosis vaccine that confers efficient protection before and after exposure. Nature medicine. 2011; 17(2); 189-194. [PubMed: 21258338].
2. Bertholet et al., 2010: Bertholet S, Ireton GC, Ordway DJ, Windish HP, Pine SO, Kahn M, Phan T, Orme IM, Vedvick TS, Baldwin SL, Coler RN, Reed SG. A defined tuberculosis vaccine candidate boosts BCG and protects against multidrug-resistant Mycobacterium tuberculosis. Science translational medicine. 2010; 2(53); 53ra74. [PubMed: 20944089].
3. Dou et al., 2010: Dou J, Tang Q, Yu F, Yang H, Zhao F, Xu W, Wang J, Hu W, Hu K, Liou C, Feng He X, Wang Y. Investigation of immunogenic effect of the BCG priming and Ag85A- GM-CSF boosting in Balb/c mice model. Immunobiology. 2010; 215(2); 133-142. [PubMed: 19450898].
4. Falero-Diaz et al., 2000: Falero-Diaz G, Challacombe S, Banerjee D, Douce G, Boyd A, Ivanyi J. Intranasal vaccination of mice against infection with Mycobacterium tuberculosis. Vaccine. 2000; 18(28); 3223-3229. [PubMed: 10869767].
5. Hall et al., 2009: Hall LJ, Clare S, Pickard D, Clark SO, Kelly DL, El Ghany MA, Hale C, Dietrich J, Andersen P, Marsh PD, Dougan G. Characterisation of a live Salmonella vaccine stably expressing the Mycobacterium tuberculosis Ag85B-ESAT6 fusion protein. Vaccine. 2009; 27(49); 6894-6904. [PubMed: 19755145].
6. Kumar et al., 2003: Kumar P, Amara RR, Challu VK, Chadda VK, Satchidanandam V. The Apa protein of Mycobacterium tuberculosis stimulates gamma interferon-secreting CD4+ and CD8+ T cells from purified protein derivative-positive individuals and affords protection in a guinea pig model. Infection and immunity. 2003; 71(4); 1929-1937. [PubMed: 12654810].
7. Li et al., 1999: Li Z, Howard A, Kelley C, Delogu G, Collins F, Morris S. Immunogenicity of DNA vaccines expressing tuberculosis proteins fused to tissue plasminogen activator signal sequences. Infection and immunity. 1999; 67(9); 4780-4786. [PubMed: 10456931].
8. Lowrie et al., 1997: Lowrie DB, Silva CL, Colston MJ, Ragno S, Tascon RE. Protection against tuberculosis by a plasmid DNA vaccine. Vaccine. 1997; 15(8); 834-838. [PubMed: 9234527].
9. Luo et al., 2004: Luo XD, Zhu DY, Chen Q, Jiang Y, Jiang S, Yang C. [A study of the protective effect of the DNA vaccine encoding tubercle antigen 85B with MPT64 in mice challenged with Mycobacterium tuberculosis]. Zhonghua jie he he hu xi za zhi = Zhonghua jiehe he huxi zazhi = Chinese journal of tuberculosis and respiratory diseases. 2004; 27(9); 611-616. [PubMed: 15498274].
10. Miki et al., 2004: Miki K, Nagata T, Tanaka T, Kim YH, Uchijima M, Ohara N, Nakamura S, Okada M, Koide Y. Induction of protective cellular immunity against Mycobacterium tuberculosis by recombinant attenuated self-destructing Listeria monocytogenes strains harboring eukaryotic expression plasmids for antigen 85 complex and MPB/MPT51. Infection and immunity. 2004; 72(4); 2014-2021. [PubMed: 15039321].
11. Morris et al., 2000: Morris S, Kelley C, Howard A, Li Z, Collins F. The immunogenicity of single and combination DNA vaccines against tuberculosis. Vaccine. 2000; 18(20); 2155-2163. [PubMed: 10715531].
12. Mukai et al., 2014: Mukai T, Tsukamoto Y, Maeda Y, Tamura T, Makino M. Efficient activation of human T cells of both CD4 and CD8 subsets by urease-deficient recombinant Mycobacterium bovis BCG that produced a heat shock protein 70-M. tuberculosis-derived major membrane protein II fusion protein. Clinical and vaccine immunology : CVI. 2014; 21(1); 1-11. [PubMed: 24152387].
13. Mustafa, 2009: Mustafa AS. Th1 cell reactivity and HLA-DR binding prediction for promiscuous recognition of MPT63 (Rv1926c), a major secreted protein of Mycobacterium tuberculosis. Scandinavian journal of immunology. 2009; 69(3); 213-222. [PubMed: 19281533].
14. Palma et al., 2007: Palma C, Iona E, Giannoni F, Pardini M, Brunori L, Orefici G, Fattorini L, Cassone A. The Ag85B protein of Mycobacterium tuberculosis may turn a protective immune response induced by Ag85B-DNA vaccine into a potent but non-protective Th1 immune response in mice. Cellular microbiology. 2007; 9(6); 1455-1465. [PubMed: 17250590].
15. Parra et al., 2004: Parra M, Pickett T, Delogu G, Dheenadhayalan V, Debrie AS, Locht C, Brennan MJ. The mycobacterial heparin-binding hemagglutinin is a protective antigen in the mouse aerosol challenge model of tuberculosis. Infection and immunity. 2004; 72(12); 6799-6805. [PubMed: 15557600].
16. Skeiky et al., 2004: Skeiky YA, Alderson MR, Ovendale PJ, Guderian JA, Brandt L, Dillon DC, Campos-Neto A, Lobet Y, Dalemans W, Orme IM, Reed SG. Differential immune responses and protective efficacy induced by components of a tuberculosis polyprotein vaccine, Mtb72F, delivered as naked DNA or recombinant protein. Journal of immunology (Baltimore, Md. : 1950). 2004 Jun 15; 172(12); 7618-28. [PubMed: 15187142].
17. Skeiky et al., 2005: Skeiky YA, Alderson MR, Ovendale PJ, Lobet Y, Dalemans W, Orme IM, Reed SG, Campos-Neto A. Protection of mice and guinea pigs against tuberculosis induced by immunization with a single Mycobacterium tuberculosis recombinant antigen, MTB41. Vaccine. 2005; 23(30); 3937-3945. [PubMed: 15917115].
18. Tanghe et al., 1999: Tanghe A, Lefèvre P, Denis O, D'Souza S, Braibant M, Lozes E, Singh M, Montgomery D, Content J, Huygen K. Immunogenicity and protective efficacy of tuberculosis DNA vaccines encoding putative phosphate transport receptors. Journal of immunology (Baltimore, Md. : 1950). 1999; 162(2); 1113-1119. [PubMed: 9916741].
19. Vipond et al., 2006: Vipond J, Clark SO, Hatch GJ, Vipond R, Marie Agger E, Tree JA, Williams A, Marsh PD. Re-formulation of selected DNA vaccine candidates and their evaluation as protein vaccines using a guinea pig aerosol infection model of tuberculosis. Tuberculosis (Edinburgh, Scotland). 2006 May-Jul; 86(3-4); 218-24. [PubMed: 16520093].
20. Wu et al., 2008: Wu Y, Woodworth JS, Shin DS, Morris S, Behar SM. Vaccine-elicited 10-kilodalton culture filtrate protein-specific CD8+ T cells are sufficient to mediate protection against Mycobacterium tuberculosis infection. Infection and immunity. 2008; 76(5); 2249-2255. [PubMed: 18332205].
21. Zaks et al., 2006: Zaks K, Jordan M, Guth A, Sellins K, Kedl R, Izzo A, Bosio C, Dow S. Efficient immunization and cross-priming by vaccine adjuvants containing TLR3 or TLR9 agonists complexed to cationic liposomes. Journal of immunology (Baltimore, Md. : 1950). 2006; 176(12); 7335-7345. [PubMed: 16751377].