VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (50)
M. tuberculosis (26)
N. meningitidis (20)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Influenza virus

Table of Contents
  1. Protective Antigens
    1. HA
    2. HA
    3. ha
    4. HA
    5. HA
    6. HA
    7. HA
    8. HA
    9. HA
    10. HA
    11. HA
    12. HA
    13. HA
    14. HA
    15. HA
    16. HA
    17. HA
    18. HA
    19. HA
    20. HA
    21. HA
    22. HA
    23. HA
    24. HA
    25. HA
    26. HA
    27. HA from A/equine/Sao Paulo/1/76(H7N7)
    28. HA from Influenza A virus (A/Aichi/2/1968(H3N2)), (X31)
    29. HA from Influenza A virus (A/Goose/Guangdong/1/96(H5N1))
    30. HA from Influenza A virus (A/Hong Kong/1/68(H3N2))
    31. HA from Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1))
    32. HA from Influenza A virus (A/Viet Nam/1203/2004(H5N1))
    33. HA from Influenza A virus (A/WSN/1933(H1N1))
    34. M1
    35. M1
    36. M2 from Influenza A virus (A/Puerto Rico/8/34(H1N1))
    37. NA
    38. NA
    39. NA
    40. NA
    41. NA from A/Puerto Rico/8/1934(H1N1)
    42. NP
    43. NP
    44. NP
    45. NP
    46. NP
    47. NP
    48. NP from Influenza A virus (A/nt/60/1968(H3N2))
    49. NP from Influenza A virus (A/Puerto Rico/8/34(H1N1))
    50. NP from Influenza B virus
1. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Equine influenza virus H3N8
  • VO ID : VO_0011112
  • NCBI Protein GI : 404517
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 907195
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.4
  • Protein Weight : 61514.34
  • Protein Length : 648
  • Protein Note : HA
  • Protein Sequence : Show Sequence
    >AAB27733.1 hemagglutinin [Influenza A virus (A/equine/Taby/1991(H3N8))]
    MKTTIILILLTHWVYSQNPTSGNNTATLCLGHHAVANGTLVKTITDDQIEVTNATELVQSISIGKICNNS
    YRVLDGRNCTLIDAMLGDPHCDDFQYENWDLFIERSSAFSNCYPYDIPDHASLRSIVASSGTLEFTAEGF
    TWTGVTQNGGSGACKRGSADSFFSRLNWLTKSGNSYPILNVTMPNNKNFDKLYIWGIHHPSSNKEQTKLY
    IQESGRVTVSTERSQQTVIPNIGSRPWVRGQSGRISIYWTIVKPGDILMINSNGNLVAPRGYFKLRTGES
    SVMRSDALIGTCVSECITPNGSIPNDKPFQNVNKVTYGKCPKYIRQNTLKLATGMRNVPEKQIRGIFGAI
    AGFIENGWEGMVDGWYGFRYQNSEGTGQAADLKSTQAAIDQINGKLNRVIERTNEKFHQIEKEFSEVEGR
    IQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDAEMNKLFEKTRRQLRENAEDMGGGCFKIYHKCDN
    ACIGSIRNGTYDHYIYRDEALNNRFQIKGVELKSGYKDWILWISFAISCLLICVVLLGFIMWACQKGNIR
    CNICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Skin and mucosal vaccination provided complete protection from clinical signs of infection with ponies subjected to a challenge infection of Equine influenza virus, while skin vaccination provided partial protection; DNA vaccination provided partial protection from viral shedding (Lunn et al., 1999).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding HA of Equine influenza virus H3N8
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.404
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
2. HA
3. ha
  • Gene Name : ha
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Italy/13474/99(H7N1))
  • VO ID : VO_0011116
  • NCBI Protein GI : 32261025
  • Other Database IDs : CDD:278910
    GOA:Q7TDW9
    HSSP: 1IBN
    InterPro: IPR000149
    InterPro: IPR001364
    InterPro: IPR008980
    InterPro: IPR013827
    InterPro: IPR013828
    InterPro: IPR013829
    UniProtKB/TrEMBL: Q7TDW9
  • Taxonomy ID : 199442
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 6.57
  • Protein Weight : 60465.11
  • Protein Length : 653
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >CAD37074.1 hemagglutinin [Influenza A virus (A/chicken/Italy/13474/99(H7N1))]
    MNTQILVFALVAIIPTNADKICLGHHAVSNGTKVNTLTERGVEVVNATETVERTNVPRICSKGKRTVDLG
    QCGLLGTITGPPQCDQFLEFSADLIIERREGSDVCYPGKFVNEEALRQILRESGGIDKEAMGFTYSGIRT
    NGTTSTCRRSGSSFYAEMKWLLSNTDNAAFPQMTKSYKNTRKDPALIIWGIHHSGSTTEQTKLYGSGNKL
    ITVGSSNYQQSFVPSPGERPQVNGQSGRIDFHWLMLNPNDTVTFSFNGAFIAPDRASFLRGKSMGIQSGV
    QVDANCEGDCYHSGGTIISNLPFQNINSRAVGKCPRYVKQESLLLATGMKNVPEIPKGSRVRRGLFGAIA
    GFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQVTGKLNRLIEKTNQQFELIDNEFTEVEKQI
    GNVINWTRDSMTEVWSYNAELLVAMENQHTIDLTDSEMNKLYERVKRLLRENAEEDGTGCFEIFHKCDDD
    CMASIRNNTYDHSKYREEAMQNRIQIDPVKLSSGYKDVILWFSFGASCFILLAIAMGLVFICVRNGNMRC
    TICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice and ferrets were immunised with two doses of the split virus vaccine (12-24 microg haemagglutinin derived from Influenza A virus (A/chicken/Italy/13474/99(H7N1))) with or without aluminium hydroxide adjuvant and challenged 3 weeks after second dose with the highly pathogenic A/chicken/Italy/13474/99 (H7N1) virus. The vaccine induced significant protection from disease after challenge with the wild-type virus. In the murine lethal challenge model, vaccination effectively prevented death and, furthermore, formulation with adjuvant reduced excessive weight loss and viral shedding (Cox et al., 2009).
  • Related Vaccine(s): Avian influenza virus DNA vaccine pCMV-HA
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.226
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
4. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza B virus (Strain B/England/222/82)
  • VO ID : VO_0011117
  • NCBI Protein GI : 122955
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 11527
  • Gene Strand (Orientation) : ?
  • Protein Name : Hemagglutinin
  • Protein pI : 8.36
  • Protein Weight : 62677.29
  • Protein Length : 761
  • Protein Note : {ECO:0000255|HAMAP-Rule:MF_04072}.
  • Protein Sequence : Show Sequence
    >sp|P10757.1|HEMA_INBEN RecName: Full=Hemagglutinin; Contains: RecName: Full=Hemagglutinin HA1 chain; Contains: RecName: Full=Hemagglutinin HA2 chain; Flags: Precursor
    MKAIIVLLMVVTSNADRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSHFANLKGTKTRGKLCP
    NCLNCTDLDVALARPKCMGTIPSAKASILHEVKPVTSGCFPIMHDRTKIRQLPNLLRGYENIKLSTRNVI
    NAERAPGGPYIIGTSGSCPNVTNGNGFFATMAWAVPKDNKTATNPLTVEVPYICTKGEDQITVWGFHSDN
    AIQMVKLYGDSKPQKFTSSANGVTTHYVSQIGGFPNQTEDGGLPQSGRIVVDYMVQKPGKTGTIVYQRGV
    LLPQKVWCASGRSKVIKGSLPLIGEADCLHEKYGGLNKSKPYYTGEHAKAIGNCPIWVKTPLKLANGTKY
    RPPAKLLKERGFFGAIAGFLEGGWEGMIAGWHGYTSHGAHGVAVAADLKSTQEAINKITKNLNSLSELEV
    KNLQRLSGAMDELHNEILELDEKVDDLRADTISSQIELAVLLSNEGIINSEDEHLLALERKLKKMLGPSA
    VDIGNGCFETKHKCNQTCLDRIAAGTFNAGEFSLPTFDSLNITAASLNDDGLDNHTILLYYSTAASSLAV
    TLMIAIFIVYMVSRDNVSCSICL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Immunization and challenge experiments in mice indicated that even though vaccination with the recombinant HA vaccinia viruses derived from Influenza B virus (Strain B/England/222/82) induced different levels of cross-reactive neutralizing antibodies, mice vaccinated with either recombinant vaccinia virus were protected from infection with either subpopulation of influenza virus (Rota et al., 1987).
  • Related Vaccine(s): Recombinant vaccinia virus encoding HA from Influenza B virus (Strain B/England/222/82)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.446
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
5. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/duck/Badung-Bali/05/2005(H5N1))
  • VO ID : VO_0011118
  • NCBI Protein GI : 190344179
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 1661658
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 6.67
  • Protein Weight : 58202.54
  • Protein Length : 623
  • Protein Note : subtype: H5N1
  • Protein Sequence : Show Sequence
    >ABG20467.2 hemagglutinin, partial [Influenza A virus (A/duck/Badung/05/2005(H5N1))]
    DQICIGYHANNSTEQVDTIMEKNVTVTHAKDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEF
    TNVPEWSYIVEKANPANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASLGVSSACPYQGQ
    SSFFRNVVWLIKKNSAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGTSTLNQRLV
    PKIATRSKVNGQSGRMEFFWTIFKPNDAINFESNGNFIAPEYAYKIVKKGDSAIMKSELEYGNCNTECQT
    PMGAINSSMPFHNIHPLTIRECPKYMKSSRLVLATGLRNSPQGERRRKKRGLFGAIAGFIEGGWQGMVDG
    WYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLD
    VWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLKDNAKELGNGCFEFYHKCDNECMESIRNGTYNYP
    QYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLAL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice vaccinated with a recombinant VLP vaccine from both influenza A H5N1 clade 1 and clade 2 isolates (Influenza A virus (A/duck/Badung-Bali/05/2005(H5N1))) with pandemic potential were protected against challenge with lethal reassortant viruses expressing the H5N1 HA and NA, regardless if the H5N1 clade was homologous or heterologous to the vaccine (Bright et al., 2008).
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.220
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
6. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/environment/Hong Kong/156/1997(H5N1))
  • VO ID : VO_0011121
  • NCBI Protein GI : 269826115
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 680785
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.18
  • Protein Weight : 62144.96
  • Protein Length : 665
  • Protein Note : passaged in allantoic fluid
  • Protein Sequence : Show Sequence
    >ACZ48512.1 hemagglutinin [Influenza A virus (A/environment/Hong Kong/156/1997(H5N1))]
    MEKTVLLLATVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILERTHNGKLCDLNGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKASPANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSN
    HDASSGVSSACPYLGRSSFFRNVVWLIKKNSAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTKLYQNP
    TTYISVGTSTLNQRLVPEIATRPKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSTI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNTPQRERRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIINKMNTQFEAVGREFNNLE
    RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESVKNGTYDYPQYSEEARLNREEISGVKLESMGTYQILSIYSTVASSLALAIMVAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Researchers report that a DNA vaccine encoding hemagglutinin from the index human influenza isolate A/HK/156/97 provides immunity against H5N1 infection of mice (Kodihalli et al., 1999).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding HA from Influenza A virus (A/environment/Hong Kong/156/1997(H5N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.254
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
7. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Solomon Islands/3/2006(H1N1))
  • VO ID : VO_0011124
  • NCBI Protein GI : 156123416
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 464623
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 6.92
  • Protein Weight : 60504.91
  • Protein Length : 654
  • Protein Note : passage level E2/E1 antigenic type LR to New Caledonia/99; adamantane sensitive
  • Protein Sequence : Show Sequence
    >ABU50586.1 hemagglutinin [Influenza A virus (A/Solomon Islands/3/2006(H1N1))]
    MKVKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCLLKGIAPLQLG
    NCSVAGWILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSW
    PNHTTTGVSASCSHNGESSFYKNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPNIGDQRALYHT
    ENAYVSVVSSHYSRKFTPEIAKRPKVRDREGRINYYWTLLEPGDTIIFEANGNLIAPRYAFALSRGFGSG
    IINSNAPMDECDAKCQTPQGAINSSLPFQNVHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIA
    GFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRM
    ENLNKKVDDGFIDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNDE
    CMESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSRVLLVSLGAISFWMCSNGSLQ
    CRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : In mouse models of influenza infection, the vaccines derived from Influenza A virus (A/Solomon Islands/3/2006(H1N1)) hemagglutinin elicit robust antibody responses that mitigate disease and protect mice from lethal challenge (Song et al., 2008).
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.302
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
8. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Yamagata/120/1986(H1N1))
  • VO ID : VO_0011126
  • NCBI Protein GI : 221344
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 379740
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 8.44
  • Protein Weight : 15771.54
  • Protein Length : 228
  • Protein Note : synonym: Influenza A virus (A/Yamagata/120/86 (H1N1))
  • Protein Sequence : Show Sequence
    >BAA02766.1 hemagglutinin, partial [Influenza A virus (A/Yamagata/120/1986(H1N1))]
    PFQNVHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSG
    YAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDDGFLDIWTYNAELLVLLE
    N
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The inoculation of HA vaccine prepared from influenza viruses A/Yamagata/120/86 (H1N1) or A/Fukuoka/C29/85 (H3N2) together with CTB provided partial protection against PR-8 infection in Balb/c mice (Tamura et al., 1989).
  • Related Vaccine(s): Influenza virus HA protein vaccine (Influenza A virus (A/Yamagata/120/1986(H1N1)))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.341
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
9. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Fukuoka/C29/85(H3N2))
  • VO ID : VO_0011127
  • NCBI Protein GI : 221306
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 62549
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 9.18
  • Protein Weight : 12806.47
  • Protein Length : 194
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >BAA02776.1 hemagglutinin, partial [Influenza A virus (A/Fukuoka/C29/1985(H3N2))]
    DKPFQNVNKITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEG
    TGQAADLKSTQAAIDQINGKLNRLIEKTNEKFHQIEKEF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The inoculation of HA vaccine prepared from influenza viruses A/Yamagata/120/86 (H1N1) or A/Fukuoka/C29/85 (H3N2) together with CTB provided partial protection against PR-8 infection in Balb/c mice (Tamura et al., 1989).
  • Related Vaccine(s): Influenza virus HA protein vaccine (Influenza A virus (A/Fukuoka/C29/85(H3N2)))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.590
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
10. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza B virus (B/Ibaraki/2/85)
  • VO ID : VO_0011128
  • NCBI Protein GI : 122959
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 107411
  • Gene Strand (Orientation) : ?
  • Protein Name : Hemagglutinin
  • Protein pI : 9.88
  • Protein Weight : 37274.43
  • Protein Length : 454
  • Protein Note : Hemagglutinin HA1 chain. /FTId=PRO_0000039110.
  • Protein Sequence : Show Sequence
    >sp|P18878.1|HEMA_INBIB RecName: Full=Hemagglutinin; Contains: RecName: Full=Hemagglutinin HA1 chain
    DRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSHFANLKGTKTRGKLCPKCLNCTDLDVALGRP
    KCMGTIPSAKASILHEVKPVTSGCFPIMHDRTKIRQLPNLLRGYENIRLSTHNVINAETAPGGPYIVGTS
    GSCPNVTNGNGFFATMAWAVPKNNNNKTATNPLTVEVPFICTEGEDQITVWGFHSDDETQMVKLYGDSKP
    QKFTSSANGVTTHYVSQIGGFPNQAEDGGLPQSGRIVVDHMVQKSGKTGTITYQRGILLPQKVSCPSGRS
    KVIKGSFPLIGEADCLHEKYGALNKSKPYYTGAHAKAIGNCPIWVKTPLKLANGTKYRPPAKLLKER
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protection against a lethal influenza B virus infection was examined in BALB/c mice immunized with plasmid DNAs encoding hemagglutinin (HA), neuraminidase (NA and NB) and nucleoprotein (NP) from the B/Ibaraki/2/85 virus. Both HA and NA DNAs conferred complete protection against the lethal challenge in all the tested mouse strains (Chen et al., 2001).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding HA from Influenza B virus (B/Ibaraki/2/85)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.699
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
11. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Indonesia/CDC669/2006(H5N1))
  • VO ID : VO_0011130
  • NCBI Protein GI : 113497156
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 400828
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 6.77
  • Protein Weight : 62447.44
  • Protein Length : 656
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >ABI36428.1 hemagglutinin [Influenza A virus (A/Indonesia/CDC669/2006(H5N1))]
    MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKANPTNDLCYPGSFNDYEELKHLLSRINHFEKIQIIPKSSWSD
    HEASSGVSSACPYLGSPSFFRNVVWLIKKNSTYPTIKKSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNP
    TTYISIGTSTLNQRLVPKIATRSKVNGQSGRMEFFWAILKPNDAINFESNGNFIAPEYAYKIVKKGDSAI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRESRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESIRNGTYNYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMIAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Viral challenge studies showed that live BacHA derived from Influenza A virus (A/Indonesia/CDC669/2006(H5N1)) was able to provide 100% protection against 5 50% mouse lethal doses (MLD(50)) of homologous (clade 2.1) and heterologous (clade 1) H5N1 (Prabakaran et al., 2010).
  • Related Vaccine(s): BacHA derived from Influenza A virus (A/Indonesia/CDC669/2006(H5N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.220
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
12. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Indonesia/CDC594/2006(H5N1))
  • VO ID : VO_0011131
  • NCBI Protein GI : 113495780
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 400810
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.01
  • Protein Weight : 62418.44
  • Protein Length : 656
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >ABI36144.1 hemagglutinin [Influenza A virus (A/Indonesia/CDC594/2006(H5N1))]
    MEKIVLLLATVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKANPANGLCYPGNFNDYEELKHLLSRINHFEKLQIIPKSSWSD
    HEASLGVSSACPYLGRSSFFRNVVWLIKKNNTYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNP
    TTYISVGTSTLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSAI
    MKSELEYGDCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRERRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESIRNGTYNYPQYSEEARLKREEISGVKLESIGIYQILSIYSTVASSLALAIMMAGLSLWMCSNG
    SLQCRVCI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Viral challenge studies showed that live BacHA derived from Influenza A virus (A/Indonesia/CDC594/2006(H5N1)) was able to provide 100% protection against 5 50% mouse lethal doses (MLD(50)) of homologous (clade 2.1) and heterologous (clade 1) H5N1 (Prabakaran et al., 2010).
  • Related Vaccine(s): BacHA derived from Influenza A virus (A/Indonesia/CDC669/2006(H5N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.217
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
13. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Hawaii/01/1991(H3N2))
  • VO ID : VO_0011132
  • NCBI Protein GI : 110313990
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 387158
  • Gene Strand (Orientation) : ?
  • Protein Name : haemagglutinin
  • Protein pI : 9.43
  • Protein Weight : 35361.77
  • Protein Length : 416
  • Protein Note : egg isolate
  • Protein Sequence : Show Sequence
    >ABG66978.1 haemagglutinin, partial [Influenza A virus (A/Hawaii/01/1991(H3N2))]
    QKLPGNDNSTATLCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGRICDSPHRILDGKNCTLIDAL
    LGDPHCDGFQNKEWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFINEDFNWTGVAQSGESYACK
    RGSVKSFFSRLNWLHKSEYKYPALNVTMPNNGKFDKLYIWGVHHPSTDREQTSLYVRASGRVTVSTKRSQ
    QTVIPNIGSRPWVRGLSSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRTGKSSIMRSDAPIGTCSSE
    CITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A DNA vaccine encoding HA (from Influenza A virus (A/Hawaii/01/1991(H3N2))), NP and M1 (from a 1989 strain) protected ferrets better against challenge with the antigenic drift variant A/Georgia/03/93 than did the inactivated vaccine from the 1992-93 influenza season. Researchers report that the same DNA vaccine protected ferrets against a second, further divergent, drift variant (A/Johannesburg/33/94) (Donnelly et al., 1997).
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.549
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
14. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Henan/12/2004(H5N1))
  • VO ID : VO_0011133
  • NCBI Protein GI : 61698018
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 319102
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.19
  • Protein Weight : 61969.572
  • Protein Length : 656
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >AAX53506.1 hemagglutinin [Influenza A virus (A/chicken/Henan/12/2004(H5N1))]
    MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKASPANGLCYPGDFNDYEELKHLLSRINHFEKIQIIPKSSWSN
    HEASSGVSSACPYQGKSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNP
    TTYISVGTSTLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSAI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRERRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Plasmids carrying the HA, NA, NP, M1, and M2 genes, respectively, of the avian influenza virus (AIV) A/Chicken/Henan/12/2004(H5N1) strain were administered to mice, and the mice were challenged with the homologous virus later. The mice immunized with HA plasmid once and the NA plasmid twice survived 100% (Chen et al., 2009).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding HA from Influenza A virus (A/chicken/Henan/12/2004(H5N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.229
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
15. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Guangdong/02/2007(H9N2))
  • VO ID : VO_0011139
  • NCBI Protein GI : 206812650
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 563925
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.03
  • Protein Weight : 60115.68
  • Protein Length : 651
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >ACI22603.1 hemagglutinin [Influenza A virus (A/chicken/Guangdong/02/2007(H9N2))]
    METVSIITMLLVVTVSNADKICIGYQSTNSTETVDTLTENNVPVTHAKELLHTEHNGMLCATTLGNPLIL
    DTCTIEGLIYGNPSCDLLLGGREWSYIVERPSAVNGLCYPGNVENLEELRSLFSSASSYQRIQIFPDTIW
    NVSYSGTSKACSDSFYRSMRWLTQKNNAYPIQDAQYTNNREKNILFMWGINHPPTDTVQTNLYTRTDTTT
    SVATEEINRTFKPLIGPRPLVNGLQGRIDYYWSVLKPGQTLRIRSNGNLIAPWYGHILSGESHGRILKTD
    LKRGSCTVQCQTEKGGLNTTLPFQNVSKYAFGNCSKYVGVKSLKLAVGLRSVPSRSSRGLFGAIAGFIEG
    GWSGLVAGWYGFQHSNDQGVGMAADKDSTQKAIDKITSKVNNIVDKMNKQYEIIDHEFSEVETRLNMINN
    KIDDQIQDIWAYNAELLVLLENQKTLDEHDANVNNLYNKVKRALGSNAVEDGKGCFELYHKCDDQCMETI
    RNGTYNRRKYQEESKLERQRIEGVKLESEGTYKILTIYSTVASSLVVAMGFAAFLFWAMSNGSCRCNICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Using reverse genetics, we constructed a recombinant NDV expressing an H9 AIV hemagglutinin (HA) from an H9N2 field isolate, A/Chicken/ Shandong/2/2007. When tested, 90% of chickens were protected from clinical disease, mortality, and virus shedding against challenge with homologous H9N2 AIV (Ge et al., 2010).
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.382
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
16. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/turkey/Ireland/1378/1983(H5N8))
  • VO ID : VO_0011141
  • NCBI Protein GI : 115279333
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 380285
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.46
  • Protein Weight : 62067.27
  • Protein Length : 657
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >ABI85117.1 hemagglutinin [Influenza A virus (A/turkey/Ireland/1378/1983(H5N8))]
    MEKIVLLFAIVSLVRSDQICIGYHANNSTKQVDTIMEKNVTVTHAQDILEKTHNGKLCSLNGVKPLILRD
    CSVAGWLLGNPMCDEFLNVPEWSYIVEKDNPVNGLCYPGDFNDYEELKHLLSCTKHFEKIRIIPRDSWPN
    HEASLGVSSACPYNGRSSFFRNVVWLIKKNNAYPTIKRSYSNTNKEDLLILWGIHHPNDAAEQTKLYQNP
    TTYVSVGTSTLNQRSIPKIATRPELNGQSGRMEFFWTILKPSDTINFESNGNFIAPEYAYKIVKKGDSAI
    MKSGLEYGNCNTKCQTPIGAINSSMPLHNIHPLTIGECPKYVKSDRLVLATGLRNTPQRKRKKRGLFGAI
    AGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQRAIDGITNKVNSIIDKMNTQFEAVGKEFNNLERR
    IENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDANVKSLYDKVRLQLKDNARELGNGCFEFYHKCDN
    ECMESIRNGTYNYPQYSEEARLNREEISGVKLESMGIYQILSIYSTVASSLALAIMIAGLSFWMCSNGSL
    QCRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : All specific-pathogen-free chickens immunized with (vFP89) expressing the native hemagglutinin (HA) gene from H5N8 A/turkey/ Ireland/1378/83 were clinically protected from HPAI challenge (Bublot et al., 2010).
  • Related Vaccine(s): FP-AI-H5(H5N1) , Influenza virus DNA vaccine pCMVH5HA , Influenza virus DNA vaccine pβactinH7HA , vFP89-H5 , vFP89-HA (H5N1 HPAI virus)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.272
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
17. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Indonesia/7/2003(H5N1))
  • VO ID : VO_0011142
  • NCBI Protein GI : 129282887
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 430432
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.16
  • Protein Weight : 62036.07
  • Protein Length : 659
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >ABO30346.1 hemagglutinin [Influenza A virus (A/chicken/Indonesia/7/2003(H5N1))]
    MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKANPANDLCYPGNLNDYEELKHLLSRINHFEKIQIIPKSSWSD
    HEASSGVSSACPYQGKSSFFRNVVWLIKKNSAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNP
    TTYISVGTSTLNQRLVPKIAIRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSAI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRERRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESIRNGTYNYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMMAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : All specific-pathogen-free chickens immunized with (vFP2211) expressing a modified synthetic HA gene from H5N1 A/chicken/Indonesia/7/2003 were clinically protected from HPAI challenge (Bublot et al., 2010).
  • Related Vaccine(s): FP-AI-H5(H5N1) , Trovac-AI-H5
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.210
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
18. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Hatay/2004/(H5N1))
  • VO ID : VO_0011143
  • NCBI Protein GI : 56311402
  • Other Database IDs : CDD:278910
    GOA:Q5QQ29
    InterPro: IPR000149
    InterPro: IPR001364
    InterPro: IPR008980
    InterPro: IPR013827
    InterPro: IPR013828
    InterPro: IPR013829
    UniProtKB/TrEMBL: Q5QQ29
  • Taxonomy ID : 303316
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.18
  • Protein Weight : 61996.08
  • Protein Length : 646
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >CAI29278.1 hemagglutinin [Influenza A virus (A/Hatay/2004/(H5N1))]
    MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCALDGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKANPVNDLCYPGDFNDYEELKHLLSRINHFEKIQIIPKSSWSS
    HEASLGVSSACPYQGKSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQIKLYQNP
    TTYISVGTSTLNQRLVPRIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKLVKKGDSTI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRERRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESVRSGTYDYPQYSEEARLKREEISGVKLESIGIYQILSIYSTVASSLALAIMVAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A neutralizing monoclonal antibody (mAb) 9F4 against the hemagglutinin (HA) of the influenza A/chicken/hatay/2004 H5N1 virus was generated. MAb 9F4 was found to be protective, both prophylactically and therapeutically, against lethal viral challenge of mice (Oh et al., 2010).
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.208
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
19. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/whooper swan/Mongolia/3/05(H5N1))
  • VO ID : VO_0011144
  • NCBI Protein GI : 81687119
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 344596
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 6.67
  • Protein Weight : 61979.74
  • Protein Length : 661
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >BAE48316.1 hemagglutinin [Influenza A virus (A/whooper swan/Mongolia/3/05(H5N1))]
    MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRD
    CSVAGWLLGNPMCDEFLNVPEWSYIVEKINPANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSD
    HEASSGVSSACPYQGRSSFFRNVVWLIKKDNAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNP
    TTYISVGTSTLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPENAYKIVKKGDSTI
    MKSELEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQGERRRRKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHRC
    DNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Chickens immunized with attenuated Salmonella strains expressing the hemagglutinin (HA1) gene from a highly pathogenic avian influenza (HPAI) H5N1 (A/whooper swan/Mongolia/3/2005) demonstrated a statistically significant increase in survival compared to control groups (Liljebjelke et al., 2010).
  • Related Vaccine(s): VSV*ΔG-H5 (H5N1)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.203
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
20. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/equine/Kentucky/1/1981(H3N8))
  • VO ID : VO_0011302
  • NCBI Nucleotide GI : 166079523
  • NCBI Protein GI : 166079524
  • Protein Accession : ABY81481.1
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 475467
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.98
  • Protein Weight : 61820.7
  • Protein Length : 654
  • Protein Note : Haemagglutinin; pfam00509
  • DNA Sequence : Show Sequence
    >gi|166079523|gb|CY028828.1| Influenza A virus (A/equine/Kentucky/1/1981(H3N8)) segment 4, complete sequence
    TCTGTCAATCATGAAGACAACCATTATTTTGATACTACTGACCCATTGGGTCTACAGTCAAAACCCAACC
    AGTGGCAACAACACAGCCACACTATGTCTGGGACACCATGCAGTAGCAAATGGAACATTGGTAAAAACAA
    TAACTGATGACCAAATTGAGGTGACAAATGCTACTGAATTAGTTCAGAGCACTTCAATAGGGAAAATATG
    CAACAACCCATATAGGGTTCTAGATGGAAGAAACTGCACATTAATAGATGCAATGCTAGGAGATCCCCAC
    TGTGATGTTTTTCAGTATGAGAATTGGGACCTCTTCATAGAAAGAAGCAGCGCTTTCAGCAATTGCTACC
    CATATGACATCCCTGACTATGCATCGCTCCGGTCTATTGTGGCATCTTCAGGAACATTAGAATTCACAGC
    AGAGGGATTCACATGGACAGGTGTCACTCAAAACGGAAGAAGTGGAGCCTGCAGAAGGGGGTCAGCCGAT
    AGTTTCTTTAGCCGACTGAATTGGCTAACAAAATCTGGAAATTCTTACCCCACATTGAATGTAACAATGC
    CTAACAATAACAATTTCGATAAACTATACATCTGGGGGATCCATCACCCGAGCACAAACAATGAGCAGAC
    AAAATTGTATATCCAAGAATCAGGGCGAGTAACAGTCTCAACAAAAAGAAGTCAACAAACAATAATCCCC
    AACATCGGATCTAGACCGTGGGTCAGGGGTCAATCAGGCAGGATAAGCATATATTGGACCATTGTGAAAC
    CTGGAGATATCCTAATGATAAACAGTAATGGCAACTTAGTTGCACCGCGGGGATATTTTAAAATGCGAAC
    AGGGAAAAGCTCTGTAATGAGATCAGATGCACCCATAGACACTTGTGTGTCCGAGTGTATTACACCAAAT
    GGAAGCATCCCCAACGACAAACCATTTCAAAATGTGAACAAAGTTACATATGGAAAATGCCCCAAGTATA
    TCAAGCAGAATACTTTGAAGCTGGCCACTGGGATGAGGAATGTACCAGAAAAGCAAATCAGAGGAATCTT
    TGGAGCAATAGCGGGATTCATAGAAAACGGCTGGGAAGGAATGGTTGATGGGTGGTATGGATTCCGATAT
    CAGAATTCGGAAGGAACAGGACAAGCTGCAGATCTAAAGAGCACTCAAGCAGCCATCGACCAGATCAATG
    GAAAATTGAACAGAGTGATTGAAAGGACCAATGAGAAATTCCATCAAATAGAGAAGGAATTCTCAGAAGT
    AGAAGGGAGAATCCAGGACTTGGAGAAGTATGTAGAAGACACCAAAATAGACCTATGGTCCTACAATGCA
    GAGTTACTGGTGGCTCTAGAAAATCAACATACGATTGACTTAACAGATGCAGAAATGAATAAATTATTCG
    AGAAGACTAGGCGCCAGTTAAGAGAAAACGCGGAAGACATGGGGGGTGGATGTTTCAAGATTTATCACAA
    ATGTGATAATGCATGCATTGGATCAATAAGAAATGGGACATATGACCATTACATATACAGAGATGAAGCA
    TTAAACAACCGATTTCAAATTAAAGGTGTTGAATTGAAATCAGGCTACAAAGATTGGATACTGTGGATTT
    CATTCGCCATATCATGCTTCTTAATTTGCGTTGTTCTATTGGGTTTCATCATGTGGGCTTGCCAAAAAGG
    CAACATCAGATGCAACATTTGCATTTGAGTAAACTGATAGTTAAA
  • Protein Sequence : Show Sequence
    >ABY81481.1 hemagglutinin [Influenza A virus (A/equine/Kentucky/1/1981(H3N8))]
    MKTTIILILLTHWVYSQNPTSGNNTATLCLGHHAVANGTLVKTITDDQIEVTNATELVQSTSIGKICNNP
    YRVLDGRNCTLIDAMLGDPHCDVFQYENWDLFIERSSAFSNCYPYDIPDYASLRSIVASSGTLEFTAEGF
    TWTGVTQNGRSGACRRGSADSFFSRLNWLTKSGNSYPTLNVTMPNNNNFDKLYIWGIHHPSTNNEQTKLY
    IQESGRVTVSTKRSQQTIIPNIGSRPWVRGQSGRISIYWTIVKPGDILMINSNGNLVAPRGYFKMRTGKS
    SVMRSDAPIDTCVSECITPNGSIPNDKPFQNVNKVTYGKCPKYIKQNTLKLATGMRNVPEKQIRGIFGAI
    AGFIENGWEGMVDGWYGFRYQNSEGTGQAADLKSTQAAIDQINGKLNRVIERTNEKFHQIEKEFSEVEGR
    IQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDAEMNKLFEKTRRQLRENAEDMGGGCFKIYHKCDN
    ACIGSIRNGTYDHYIYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLICVVLLGFIMWACQKGNIR
    CNICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Skin and mucosal vaccination of ponies with HA from influenza virus A/equine/Ky/1/81 provided complete protection from clinical signs of infection after challenge, while skin vaccination provided partial protection; DNA vaccination provided partial protection from viral shedding (Lunn et al., 1999).
  • Related Vaccine(s): Influenza virus DNA vaccine BacPAKHA encoding EqfKY HA , Influenza virus DNA vaccine encoding HA from Influenza A virus (A/equine/Kentucky/1/1981(H3N8))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.444
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
21. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : A/seal/Massachusetts/1/1980(H7N7)
  • NCBI Protein GI : 119952175
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 680613
  • Gene Strand (Orientation) : ?
  • Protein Name : haemagglutinin
  • Protein pI : 6.15
  • Protein Weight : 60531.01
  • Protein Length : 652
  • Protein Note : synonym: Influenza A virus (A/seal/Massachusetts/1/80(H7N7))
  • Protein Sequence : Show Sequence
    >BAF02934.2 haemagglutinin [Influenza A virus (A/seal/Massachusetts/1/1980(H7N7))]
    MNTQILVFIACVLIEAKGDKICLGHHAVANGTKVNTLTERGIEVVNATETVETANIGKICTQGKRPTDLG
    QCGLLGTLIGPPQCDQFLEFESNLIIERREGNDVCYPGKFTNEESLRQILRGSGGVDKESMGFTYSGIRT
    NGATSACRRSGSSFYAEMKWLLSNSDNAAFPQMTKSYRNPRNKPALIVWGIHHSGSTTEQTRLYGSGNKL
    ITVGSSKYQQSFTPSPEARPQVNGQSGRIDFHWLLLDPNDTVTFTFNGAFIAPNRASFFRGESLGVQSDV
    PLDSNCGGDCFHSGGTIVSSLPFQNINSRTVGKCPRYVKQPSLLSATGMRNVPENPKTRGLFGAIAGFIE
    NGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGTLNRLIDKTNQQFELIDNEFNEIEQQIGNVI
    NWTRDSMTEVWSYNAELLVAMENQHTIDLADSEMNKLYERVRKQLRENAEEDGTGCFEIFHKCDDQCMES
    IRNNTYDHTQYRAESLQNRIQIDPVKLSSGYKDIILWFSFGASCFLLLAIAMGLVFICIKNGNMRCTICI
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Influenza virus DNA vaccine p188 encoding H7 , RSV-H7 , Schmidt-Ruppin Rous sarcoma virus-H7 (H7N7)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.407
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
22. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : A/swine/Taiwan/HL-1125/2009(H1N1)
  • NCBI Protein GI : 317015046
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 937779
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.21
  • Protein Weight : 60619.17
  • Protein Length : 658
  • Protein Note : lineage: swl
  • Protein Sequence : Show Sequence
    >ADU85609.1 hemagglutinin [Influenza A virus (A/swine/Taiwan/HL-1125/2009(H1N1))]
    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLRGVAPLHLG
    KCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSW
    PNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQ
    NADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWILVEPGDKITFEATGNLVVPRYAFAMERNAGS
    GIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI
    AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR
    IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDN
    TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSL
    QCRICI
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): AcHERV-sH1N1-HA
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.529
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
23. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Indonesia/5/2005(H5N1))
  • NCBI Protein GI : 145284450
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 400788
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 6.89
  • Protein Weight : 62158.19
  • Protein Length : 651
  • Protein Note : passage level E
  • Protein Sequence : Show Sequence
    >ABP51969.1 hemagglutinin [Influenza A virus (A/Indonesia/5/2005(H5N1))]
    MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKANPTNDLCYPGSFNDYEELKHLLSRINHFEKIQIIPKSSWSD
    HEASSGVSSACPYLGSPSFFRNVVWLIKKNSTYPTIKKSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNP
    TTYISIGTSTLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSAI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRESRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESIRNGTYNYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMMAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): dVV-HA5(H5N1) , Influenza virus DNA vaccine H5 DNA
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.220
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
24. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Hubei/489/2004(H5N1))
  • NCBI Nucleotide GI : 55233227
  • NCBI Protein GI : 55233228
  • Protein Accession : AAV48546.1
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 298603
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.05
  • Protein Weight : 61897.8
  • Protein Length : 657
  • Protein Note : Haemagglutinin; pfam00509
  • DNA Sequence : Show Sequence
    >gi|55233227|gb|AY770079.1| Influenza A virus (A/chicken/Hubei/489/2004(H5N1)) hemagglutinin (HA) gene, complete cds
    AGCAAAAGCAGGGGTATAATCTGTCAAAATGGAGAAAATAGTGCTTCTTCTTGCAATAGTCAGTCTTGTT
    AAAAGTGATCAGATTTGCATTGGTTACCATGCAAACAACTCGACAGAGCAGGTCGACACAATAATGGAAA
    AGAACGTTACTGTTACACATGCCCAAGACATACTGGAAAAGACACACAACGGGAAGCTCTGCGATCTAGA
    TGGAGTGAAGCCTCTAATTTTGAGAGATTGTAGTGTAGCTGGATGGCTCCTCGGAAACCCAATGTGTGAC
    GAATTCATCAATGTGCCGGAATGGTCTTACATAGTGGAGAAGGCCAGTCCAGCCAATGACCTCTGTTACC
    CAGGGGATTTCAACGACTATGAAGAACTGAAACACCTATTGAGCAGAATAAACCATTTTGAGAAAATTCA
    GATCATCCCCAAAAGTTCTTGGTCCAATCATGAAGCCTCATCAGGGGTGAGCTCAGCATGTCCATACCTG
    GGAAAGTCCTCCTTTTTCAGAAATGTGGTATGGCTTATCAAAAAGAACAGTACATACCCAACAATAAAGA
    GGAGCTACAATAATACCAACCAAGAAGATCTTTTGGTACTGTGGGGGATTCACCATCCTAATGATGCGGC
    AGAGCAGACAAGGCTCTATCAAAACCCAACCACTTATATTTCCGTTGGAACATCAACACTAAACCAGAGA
    TTGGTACCAAAAATAGCTACTAGATCCAAAGTAAACGGGCAAAGTGGAAGGATGGAGTTCTTCTGGACAA
    TTTTAAAACCGAATGATGCAATCAATTTCGAGAGTAATGGAAATTTCATTGCTCCAGAATATGCATACAA
    AATTGTCAAGAAAGGGGACTCAGCAATTATGAAAAGTGAATTGGAATATGGTAACTGCAACACCAAGTGT
    CAAACTCCAATGGGGGCGATAAACTCTAGTATGCCATTCCACAACATACACCCTCTCACCATCGGGGAAT
    GCCCCAAATATGTGAAATCAAACAGATTAGTCCTTGCGACTGGGCTCAGAAATAGCCCTCAAAGAGAGAG
    AAGAAGAAAAAAGAGAGGACTATTTGGAGCTATAGCAGGTTTTATAGAGGGAGGATGGCAGGGAATGGTA
    GATGGTTGGTATGGGTACCACCATAGCAATGAGCAGGGGAGTGGATACGCTGCAGACAAAGAATCCACTC
    AAAAGGCAATAGATGGAGTCACCAATAAGGTCAACTCGATCATTGACAAAATGAACACTCAGTTTGAGGC
    CGTTGGAAGGGAATTTAATAACTTAGAAAGGAGAATAGAGAATTTAAACAAGAAGATGGAAGACGGATTC
    CTAGATGTCTGGACTTATAATGCTGAACTTCTGGTTCTCATGGAAAATGAGAGAACTCTAGACTTTCATG
    ACTCAAATGTCAAGAACCTTTACGACAAGGTCCGACTACAGCTTAGGGATAATGCAAAAGAGCTGGGTAA
    CGGTTGTTTCGAGTTCTATCACAAATGTGATAATGAATGTATGGAAAGTGTAAGAAACGGAACGTATGAC
    TACCCGCAGTATTCAGAAGAAGCAAGACTAAAAAGAGAGGAAATAAGTGGAGTAAAATTGGAATCAATAG
    GAACTTACCAAATACTGTCAATTTATTCAACAGTGGCGAGTTCCCTAGCACTGGCAATCATGGTAGCTGG
    TCTATCTTTATGGATGTGCTCCAATGGATCGTTACAATGCAGAATTTGCATTTAAATTTGTGAGTTCAGA
    TTGTAGTTAAAAACACCCTTGTTTCTACT
  • Protein Sequence : Show Sequence
    >AAV48546.1 hemagglutinin [Influenza A virus (A/chicken/Hubei/489/2004(H5N1))]
    MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKASPANDLCYPGDFNDYEELKHLLSRINHFEKIQIIPKSSWSN
    HEASSGVSSACPYLGKSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNP
    TTYISVGTSTLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSAI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRERRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Influenza virus DNA vaccine pHA/NP147–155 encoding NP147-155
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.212
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
25. HA
  • Gene Name : HA
  • Sequence Strain (Species/Organism) : synthetic construct
  • NCBI Nucleotide GI : 89994009
  • NCBI Protein GI : 89994010
  • Protein Accession : ABD83813.1
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : codon-optimized hemagglutinin
  • Protein pI : 6.56
  • Protein Weight : 61265.95
  • Protein Length : 642
  • Protein Note : derived from influenza A virus strain A/goose/Guangdong/1/96(H5N1); GSGD96
  • DNA Sequence : Show Sequence
    >gi|89994009|gb|DQ420166.1| Synthetic construct codon-optimized hemagglutinin (HA) gene, complete cds
    ATGGAGAAGATCGTGCTGCTGCTGGCCATCGTGAGCCTGGTGAAGAGCGACCAGATCTGCATCGGCTACC
    ACGCCAACAACAGCACCGAGCAGGTGGACACCATCATGGAGAAGAACGTGACCGTGACCCACGCCCAGGA
    CATCCTGGAGAAGACCCACAACGGCAAGCTGTGCGACCTGAACGGCGTGAAGCCCCTGATCCTGCGCGAC
    TGCAGCGTGGCCGGCTGGCTGCTGGGCAACCCCATGTGCGACGAGTTCATCAACGTGCCCGAGTGGAGCT
    ACATCGTGGAGAAGGCCAGCCCCGCCAACGACCTGTGCTACCCCGGCGACTTCAACGACTACGAGGAGCT
    GAAGCACCTGCTGAGCCGCACCAACCACTTCGAGAAGATCCAGATCATCCCCAAGAGCAGCTGGAGCAAC
    CACGACGCCAGCAGCGGCGTGAGCAGCGCCTGCCCCTACCACGGCCGCAGCAGCTTCTTCCGCAACGTGG
    TGTGGCTGATCAAGAAGAACAGCGCCTACCCCACCATCAAGCGCAGCTACAACAACACCAACCAGGAGGA
    CCTGCTGGTGCTGTGGGGCATCCACCACCCCAACGACGCCGCCGAGCAGACCAAGCTGTACCAGAACCCC
    ACCACCTACATCAGCGTGGGCACCAGCACCCTGAACCAGCGCCTGGTGCCCGAGATCGCCACCCGCCCCA
    AGGTGAACGGGCAGAGCGGCCGCATGGAGTTCTTCTGGACCATCCTGAAGCCCAACGACGCCATCAACTT
    CGAGAGCAACGGCAACTTCATCGCCCCCGAGTACGCCTACAAGATCGTGAAGAAGGGCGACAGCGCCATC
    ATGAAGAGCGAGCTGGAGTACGGCAACTGCAACACCAAGTGCCAGACCCCCATGGGCGCCATCAACAGCA
    GCATGCCCTTCCACAACATCCACCCCCTGACCATCGGCGAGTGCCCCAAGTACGTGAAGAGCAACCGCCT
    GGTGCTGGCCACCGGCCTGCGCAACACCCCCCAGCGCGAGCGCCGCCGCAAGAAGCGCGGCCTGTTCGGC
    GCCATCGCCGGCTTCATCGAGGGCGGCTGGCAGGGCATGGTGGACGGCTGGTACGGGTACCACCACAGCA
    ACGAGCAGGGCAGCGGCTACGCCGCCGACAAGGAGAGCACCCAGAAGGCCATCGACGGCGTGACCAACAA
    GGTGAACAGCATCATCGACAAGATGAACACCCAGTTCGAGGCCGTGGGCCGCGAGTTCAACAACCTGGAG
    CGCCGCATCGAGAACCTGAACAAGCAGATGGAGGACGGCTTCCTGGACGTGTGGACCTACAACGCCGAGC
    TGCTGGTGCTGATGGAGAACGAGCGCACCCTGGACTTCCACGACAGCAACGTGAAGAACCTGTACGACAA
    GGTGCGCCTGCAGCTGCGCGACAACGCCAAGGAGCTGGGCAACGGCTGCTTCGAGTTCTACCACAAGTGC
    GACAACGAGTGCATGGAGAGCGTGAAGAACGGCACCTACGACTACCCCCAGTACAGCGAGGAGGCCCGCC
    TGAACCGCGAGGAGATCAGCGGCGTGAAGCTGGAGAGCATGGGCACCTACCAGATCCTGAGCATCTACAG
    CACCGTGGCCAGCAGCCTGGCCCTGGCCATCATGGTGGCCGGCCTGAGCCTGTGGATGTGCAGCAACGGC
    AGCCTGCAGTGCCGCATCTGCATCTAA
  • Protein Sequence : Show Sequence
    >ABD83813.1 codon-optimized hemagglutinin [synthetic construct]
    MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKASPANDLCYPGDFNDYEELKHLLSRTNHFEKIQIIPKSSWSN
    HDASSGVSSACPYHGRSSFFRNVVWLIKKNSAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTKLYQNP
    TTYISVGTSTLNQRLVPEIATRPKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSAI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNTPQRERRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKQMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESVKNGTYDYPQYSEEARLNREEISGVKLESMGTYQILSIYSTVASSLALAIMVAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.230
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
26. HA
  • Gene Name : HA
  • NCBI Nucleotide GI : 516372
  • NCBI Protein GI : 516373
  • Protein Accession : CAA40729.1
  • Other Database IDs : CDD:278910
    GOA:Q67089
    HSSP: 1JSD
    InterPro: IPR000149
    InterPro: IPR001364
    InterPro: IPR008980
    InterPro: IPR013827
    InterPro: IPR013828
    UniProtKB/TrEMBL: Q67089
  • Taxonomy ID : 380342
  • Gene Strand (Orientation) : ?
  • Protein Name : haemagglutinin
  • Protein pI : 8.2
  • Protein Weight : 37805.44
  • Protein Length : 449
  • Protein Note : Haemagglutinin; pfam00509
  • DNA Sequence : Show Sequence
    >gi|516372|emb|X57492.1| Influenza A virus (A/swine/Iowa/15/30(H1N1)) HA1 and HA2 genes for haemagglutinin, genomic RNA
    ATGAAGGCAAGACTATTAGTCTTGTTATGTGCATTTGCATCTACAAATGCAGACACACTATGTATAGGTT
    ACCATGCAAATAACTCAACCGACACTGTTGACACAGTACTCGAGAAGAATGTAACCGTGACACACTCTGT
    TAACCTGCTTGAAGACAGCCACAACGGAAAACTATGTAGACTGGGAGGAATAGCCCCATTACAACTGGGG
    AAATGTAATATTGCCGGATGGCTCTTGGGAAACCCAGAATGCGATTTGCTGCTCACAGTGAGCTCATGGT
    CCTATATTGTAGAAACACGGACCTCAGATAATGGGACATGTTACCCAGGAGATTTCATCGACTATGAAGA
    ACTGAGAGAGCAACTGAACTCAATGTCATCATTCGAAAAATTCGAGATATTTCCCAAGACAAGCTCGTGG
    CCCAATCATGAAACAACCAAAGGTGTAACGGCAGCATGCCCCTATGCTGGAGCAAGCAGCTTTTACAGAA
    ACTTACTATGGCTGGTAAAGAAGGAAAATTCATACCCAAAGCTTAGCAAATCCTATGTTAACAATAAAGG
    AAAAGAAGTCCTTGTGCTATGGGGTGTTCATCATCCGCCTACCAGTACTGATCAACAAAGTCTCTATCAA
    AATGCAGATGCTTATGTTTCTGTAGGGTCATCAAAATATTACAGGAGGTTCACTCCAGAAATAGCAGCGA
    GACCCAAAGTGAGAGGTCAGGCAGGGAGGATGAACTATTACTGGACATTACTAGAACCCGGAGACACAAT
    AACATTTGAGGCAACTGGAAATTTAGTGGCACCAAGATATGCTTTCGCACTGAATAGAGGTTCTGGATCC
    GGTATCATCACTTCAAACGCACCAGTGCATGATTGTGACACGAAGTGTCAAACACCTCATGGTGCCATAA
    ACAGCAGTCTCCCTTTCCAGAATGTACATCCAGTCACAATAGGAGAGTGCCCAAAATACGTCAAGAGCAC
    CAAATTAAGGATGGTTACAGGACTAAGAAACATCCCATCTATCCAGTCTAGAGGTCTGTTTGGAGCCATT
    GCCGGTTTTATTGAGGGGGGATGGACTGGATTGATAGATGGATGGTATGGTTACCATCATCAGAATGGAC
    AGGGATCAGGCTATGCAGCGGACCAAAAGAGCACACAAAATGCCATTGACGGGATTACTAACAAGGTGAA
    TTCTGTTATCGAGAAGATGAACACGCAATTCACAGCAGTGGGTAAAGAATTCAACAACCTAGAAAGAAGG
    ATAGAAAATTTAAATAAAAAAGTCGATGATGGATTTCTGGATATTTGGACATATAATGCAGAACTGTTAG
    TTCTATTGGAAAATGAGAGGACTCTGGATTTCCATGACTCAAATGTAAAGAACCTGTATGAGAAAGTAAG
    AAGCCAACTAAGGAATAATGCCAAGGAAATCGGGAATGGATGCTTTGAATTCTACCACAAATGTGATGAT
    ACATGCATGGAAAGCGTCAGAAATGGGACTTATGATTACCCAAAGTATTCAGAAGAATCAAAATTGAACA
    GAGAAGAAATAGATGGAGTGAAATTGGAATCAATGATGGTCTATCAGATTCTGGCGATCTATTCAACCGT
    CGCCAGTTCACTAGTGCTGTTAGTCTCCCTGGGGGGAATCAGCTTCTGGATGTGTTCTAATGGGTCTTTG
    CAGTGCAGAATATGTATTTAA
  • Protein Sequence : Show Sequence
    >CAA40729.1 haemagglutinin, partial [Influenza A virus (A/swine/Iowa/15/1930(H1N1))]
    MKARLLVLLCAFASTNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLGGIAPLQLG
    KCNIAGWLLGNPECDLLLTVSSWSYIVETRTSDNGTCYPGDFIDYEELREQLNSMSSFEKFEIFPKTSSW
    PNHETTKGVTAACPYAGASSFYRNLLWLVKKENSYPKLSKSYVNNKGKEVLVLWGVHHPPTSTDQQSLYQ
    NADAYVSVGSSKYYRRFTPEIAARPKVRGQAGRMNYYWTLLEPGDTITFEATGNLVAPRYAFALNRGSGS
    GIITSNAPVHDCDTKCQTPHGAINSSLPFQNVHPVTIGECPKYVKSTKLRMVTGLRNIPSIQSRGLFGAI
    AGFIEGG
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): PrV-HA (swine-origin H1N1)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.718
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
27. HA from A/equine/Sao Paulo/1/76(H7N7)
  • Gene Name : HA from A/equine/Sao Paulo/1/76(H7N7)
  • Sequence Strain (Species/Organism) : A/equine/Sao Paulo/1/76(H7N7)
  • NCBI Protein GI : 59208
  • Other Database IDs : CDD:278910
    GOA:P26102
    InterPro: IPR000149
    InterPro: IPR001364
    InterPro: IPR008980
    InterPro: IPR013827
    InterPro: IPR013828
    InterPro: IPR013829
    UniProtKB/UniProt: P26102
  • Taxonomy ID : 217828
  • Gene Strand (Orientation) : ?
  • Protein Name : heamagglutinin
  • Protein pI : 8.17
  • Protein Weight : 63215.53
  • Protein Length : 659
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >CAA44436.1 heamagglutinin [Influenza A virus (A/equine/Sao Paulo/1/76(H7N7))]
    MNTQILILAISAFLCVRADKICLGHHAVSNGTKVDTLTEKGIEVVNATETVEQKNIPKICSKGKQTIDLG
    QCGLLGTTIGPPQCDQFLEFSANLIIERREGDDICYPGKFDNEETLRQILRKSGGIKKENMGFTYTGVRT
    NGETSACRRSRSSFYAEMKWLLSNTDNGVFPQMTKSYKNTKREPALIIWGIHHSGSTAEQTRLYGSGNKL
    VTVWSSKYQRSFAPNPGPRPQINGQSGRIDFYWLMLDPNDTVTFSFNGAFIAPDRASFLRGKSLGIQSDA
    QLDNNCEGECYHIGGTIISNLPFQNINSRAIGKCPRYVKQKSLMLATGMKNVPENSTHKQLTHHMRKKRG
    LFGAIAGFIENGWEGLIDGWYGYRHQNAQGEGTAADYKSTQSAINQITGKLNRLIEKTNQQFELIDNEFN
    EIEKQIGNVINWTRDSIIEVWSYNAEFLVAVENQHTIDLTDSEMNKLYEKVRRQLRENAEEDGNGCFEIF
    HQCDNDCMASIRNNTYDHKKYRKEAIQNRIQIDAVKLSSGYKDIILWFSFGASCFLFLAIAMVLAFICIK
    NGNMRCTICI
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Influenza virus DNA vaccine pCMV/H7
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.284
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
28. HA from Influenza A virus (A/Aichi/2/1968(H3N2)), (X31)
  • Gene Name : HA from Influenza A virus (A/Aichi/2/1968(H3N2)), (X31)
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Aichi/2/1968(H3N2)), (X31)
  • VO ID : VO_0011115
  • NCBI Protein GI : 324132
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 387139
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin precursor
  • Protein pI : 6.76
  • Protein Weight : 61327.01
  • Protein Length : 655
  • Protein Note : signal peptide
  • Protein Sequence : Show Sequence
    >AAA43178.1 hemagglutinin precursor [Influenza A virus (A/Aichi/2/1968(H3N2))]
    MKTIIALSYIFCLALGQDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNN
    PHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEG
    FTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGIHHPSTNQEQTSL
    YVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGK
    SSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGA
    IAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEG
    RIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCD
    NACIESIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMWACQRGNI
    RCNICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Two cyclic peptide analogues corresponding to residues 139-146 (site A) of influenza A virus haemagglutinin (strain X31) were synthesized. When OF1 mice were immunized with cyclic peptides, approximately 80% of the animals were protected against an intranasal challenge with influenza virus (Muller et al., 1990).
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.370
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
29. HA from Influenza A virus (A/Goose/Guangdong/1/96(H5N1))
  • Gene Name : HA from Influenza A virus (A/Goose/Guangdong/1/96(H5N1))
  • Sequence Strain (Species/Organism) : Influenza A virus (A/goose/Guangdong/1/1996(H5N1))
  • VO ID : VO_0011125
  • NCBI Gene ID : 3654620
  • NCBI Protein GI : 73852955
  • Locus Tag : FLUAVH5N1_s4gp1
  • Genbank Accession : AF144305
  • Protein Accession : YP_308669
  • Taxonomy ID : 93838
  • Segment No : segment 4
  • Gene Starting Position : 21
  • Gene Ending Position : 1727
  • Gene Strand (Orientation) : +
  • Protein Name : hemagglutinin
  • Protein pI : 6.67
  • Protein Weight : 61079.8
  • Protein Length : 568
  • DNA Sequence : Show Sequence
    >NC_007362.1:21-1727 Influenza A virus (A/goose/Guangdong/1/1996(H5N1)) hemagglutinin (HA) gene, complete cds
    AATGGAGAAAATAGTGCTTCTTCTTGCAATAGTCAGTCTTGTCAAAAGTGATCAGATTTGCATTGGTTAC
    CATGCAAACAACTCGACAGAGCAGGTTGACACAATAATGGAAAAGAACGTTACTGTTACACATGCCCAAG
    ACATACTGGAAAAGACACACAATGGGAAGCTCTGCGATCTAAATGGAGTGAAGCCTCTCATTTTGAGAGA
    TTGTAGTGTAGCTGGATGGCTCCTCGGAAACCCTATGTGTGACGAATTCATCAATGTGCCGGAATGGTCT
    TACATAGTGGAGAAGGCCAGTCCAGCCAATGACCTCTGTTACCCAGGGGATTTCAACGACTATGAAGAAC
    TGAAACACCTATTGAGCAGAACAAACCATTTTGAGAAAATTCAGATCATCCCCAAAAGTTCTTGGTCCAA
    TCATGATGCCTCATCAGGGGTGAGCTCAGCATGTCCATACCATGGGAGGTCCTCCTTTTTCAGAAATGTG
    GTATGGCTTATCAAAAAGAACAGTGCATACCCAACAATAAAGAGGAGCTACAATAATACCAACCAAGAAG
    ATCTTTTAGTACTGTGGGGGATTCACCATCCTAATGATGCGGCAGAGCAGACAAAGCTCTATCAAAACCC
    AACCACTTACATTTCCGTTGGAACATCAACACTGAACCAGAGATTGGTTCCAGAAATAGCTACTAGACCC
    AAAGTAAACGGGCAAAGTGGAAGAATGGAGTTCTTCTGGACAATTTTAAAGCCGAATGATGCCATCAATT
    TCGAGAGTAATGGAAATTTCATTGCTCCAGAATATGCATACAAAATTGTCAAGAAAGGGGACTCAGCAAT
    TATGAAAAGTGAATTGGAATATGGTAACTGCAACACCAAGTGTCAAACTCCAATGGGGGCGATAAACTCT
    AGTATGCCATTCCACAACATACACCCCCTCACCATCGGGGAATGCCCCAAATATGTGAAATCAAACAGAT
    TAGTCCTTGCGACTGGACTCAGAAATACCCCTCAGAGAGAGAGAAGAAGAAAAAAGAGAGGACTATTTGG
    AGCTATAGCAGGTTTTATAGAGGGAGGATGGCAGGGAATGGTAGATGGTTGGTATGGGTACCACCATAGC
    AATGAGCAGGGGAGTGGATACGCTGCAGACAAAGAATCCACTCAAAAGGCAATAGATGGAGTCACCAATA
    AGGTCAACTCGATCATTGACAAAATGAACACTCAGTTTGAGGCCGTTGGAAGGGAATTTAATAACTTGGA
    AAGGAGGATAGAGAATTTAAACAAGCAGATGGAAGACGGATTCCTAGATGTCTGGACTTATAATGCTGAA
    CTTCTGGTTCTCATGGAAAATGAGAGAACTCTAGACTTTCATGACTCAAATGTCAAGAACCTTTATGACA
    AGGTCCGACTACAGCTTAGGGATAATGCAAAGGAGCTGGGTAATGGTTGTTTCGAGTTCTATCACAAATG
    TGATAATGAATGTATGGAAAGTGTAAAAAACGGAACGTATGACTACCCGCAGTATTCAGAAGAAGCAAGA
    CTAAACAGAGAGGAAATAAGTGGAGTAAAATTGGAATCAATGGGAACTTACCAAATACTGTCAATTTATT
    CAACAGTGGCGAGTTCCCTAGCACTGGCAATCATGGTAGCTGGTCTATCTTTATGGATGTGCTCCAATGG
    ATCGTTACAATGCAGAATTTGCATTTA
    
    
  • Protein Sequence : Show Sequence
    >YP_308669.1 hemagglutinin [Influenza A virus (A/goose/Guangdong/1/1996(H5N1))]
    MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKASPANDLCYPGDFNDYEELKHLLSRTNHFEKIQIIPKSSWSN
    HDASSGVSSACPYHGRSSFFRNVVWLIKKNSAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTKLYQNP
    TTYISVGTSTLNQRLVPEIATRPKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSAI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNTPQRERRRKKRGLFG
    AIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLE
    RRIENLNKQMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKC
    DNECMESVKNGTYDYPQYSEEARLNREEISGVKLESMGTYQILSIYSTVASSLALAIMVAGLSLWMCSNG
    SLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Results indicated that two doses of 10 microg of pCAGGoptiHA derived from Influenza A virus (A/Goose/Guangdong/1/96(H5N1)) could induce complete protection in chickens against H5 lethal virus challenge (Jiang et al., 2007).
  • Related Vaccine(s): Influenza virus DNA vaccine pCAGGHA , Influenza virus DNA vaccine pCAGGoptiHA , pCAGGoptiHA
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.230
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
30. HA from Influenza A virus (A/Hong Kong/1/68(H3N2))
  • Gene Name : HA from Influenza A virus (A/Hong Kong/1/68(H3N2))
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Hong Kong/1/68(H3N2))
  • VO ID : VO_0011120
  • NCBI Protein GI : 16960108
  • Taxonomy ID : 10090
  • Gene Strand (Orientation) : ?
  • Protein Length : 377
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Vaccination with HA-VRP derived from Influenza A virus (A/Hong Kong/1/68(H3N2)) did not strongly stimulate either neutralizing or IgG1 antibodies but did induce IgG2a antibodies. Expression of IgG2a antibodies in this context correlated with clearance of virus and increased protection against lethal influenza challenge (Huber et al., 2006).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding HA from Influenza A virus (A/Hong Kong/1/68(H3N2))
31. HA from Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1))
  • Gene Name : HA from Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1))
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1))
  • VO ID : VO_0011140
  • NCBI Nucleotide GI : 46578137
  • NCBI Protein GI : 46578138
  • Protein Accession : AAS65615.2
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 266827
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 7.31
  • Protein Weight : 62751.75
  • Protein Length : 669
  • Protein Note : Haemagglutinin; pfam00509
  • DNA Sequence : Show Sequence
    >gi|46578137|gb|AY555150.2| Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1)) hemagglutinin gene, partial cds
    TCATCTGTCAAATGGAGAAAATAGTGCTTCTTTTTGCAATAGTCAGTCTTGTTAAAAGTGATCAGATTTG
    CATTGGTTACCATGCAAACAACTCGACAGAGCAGGTTGACACAATAATGGAAAAGAACGTTACTGTTACA
    CATGCCCAAGACATACTGGAAAAGACACACAACGGGAAGCTCTGCGATCTAGATGGAGTGAAGCCTCTAA
    TTTTGAGAGATTGTAGTGTAGCTGGATGGCTCCTCGGAAACCCAATGTGTGACGAATTCATCAATGTGCC
    GGAATGGTCCTACATAGTGGAGAAGGCCAATCCAGTCAATGACCTCTGTTACCCAGGGGATTTCAATGAC
    TATGAAGAATTGAAACACCTATTGAGCAGAATAAACCATTTTGAGAAAATTCAGATCATCCCCAAAAGTT
    CTTGGTCCAGTCATGAAGCCTCATTAGGGGTGAGCTCAGCATGTCCATACCAGAGAAAGTCCTCCTTTTT
    CAGAAATGTGGTATGGCTTATCAAAAAGAACAGTACATACCCAACAATAAAGAGGAGCTACAATAATACC
    AACCAAGAAGATCTTTTGGTACTGTGGGGGATTCACCATCCTAATGATGCGGCAGAGCAGACAAAGCTCT
    ATCAAAACCCAACCACCTATATTTCCGTTGGGACATCAACACTAAACCAGAGATTGGTACCAAGAATAGC
    TACTAGATCCAAAGTAAACGGGCAAAGTGGAAGGATGGAGTTCTTCTGGACAATTTTAAAACCGAATGAT
    GCAATCAACTTCGAGAGTAATGGAAATTTCATTGCTCCAGAATATGCATACAAAATTGTCAAGAAAGGGG
    ACTCAACAATTATGAAAAGTGAATTGGAATATGGTAACTGCAACACCAAGTGTCAAACTCCAATGGGGGC
    GATAAACTCTAGTATGCCATTCCACAATATACACCCTCTCACCATCGGGGAATGCCCCAAATATGTGAAA
    TCAAACAGATTAGTCCTTGCGACTGGGCTCAGAAATAGCCCTCAAAGAGAGAGAAGAAGAAAAAAGAGAG
    GATTATTTGGAGCTATAGCAGGTTTTATAGAGGGAGGATGGCAGGGAATGGTAGATGGTTGGTATGGGTA
    CCACCATAGCAATGAGCAGGGGAGTGGGTACGCTGCAGACAAAGAATCCACTCAAAAGGCAATAGATGGA
    GTCACCAATAAGGTCAACTCGATCATTGACAAAATGAACACTCAGTTTGAGGCCGTTGGAAGGGAATTTA
    ACAACTTAGAAAGGAGAATAGAGAATTTAAACAAGAAGATGGAAGACGGGTTCCTAGATGTCTGGACTTA
    TAATGCTGAACTTCTGGTTCTCATGGAAAATGAGAGAACTCTAGACTTTCATGACTCAAATGTCAAGAAC
    CTTTACGACAAGGTCCGACTACAGCTTAGGGATAATGCAAAGGAACTGGGTAACGGTTGTTTCGAGTTCT
    ATCATAAATGTGATAATGAATGTATGGAAAGTGTAAGAAACGGAACGTATGACTACCCGCAGTATTCAGA
    AGAAGCAAGACTAAAAAGAGAGGAAATAAGTGGAGTAAAATTGGAATCAATAGGAATTTACCAAATACTG
    TCAATTTATTCTACAGTGGCGAGTTCCCTAGCACTGGCAATCATGGTAGCTGGTCTATCCTTATGGATGT
    GCTCCAATGGGTCGTTACAATGCAGAATTTGCATTTAAATTTGTGAGTTCAGATTG
  • Protein Sequence : Show Sequence
    >AAS65615.2 hemagglutinin, partial [Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1))]
    ICQMEKIVLLFAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLI
    LRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPVNDLCYPGDFNDYEELKHLLSRINHFEKIQIIPKSS
    WSSHEASLGVSSACPYQRKSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTKLY
    QNPTTYISVGTSTLNQRLVPRIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGD
    STIMKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRERRRKKRG
    LFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFN
    NLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFY
    HKCDNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGIYQILSIYSTVASSLALAIMVAGLSLWMC
    SNGSLQCRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Immunization with DNA/rAd5 vaccines encoding HA derived from Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1)) conferred protection in ferrets against a stringent virus challenge (Rao et al., 2010).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding HA from Influenza A virus (A/Thailand/1(KAN-1)/2004(H5N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.200
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
32. HA from Influenza A virus (A/Viet Nam/1203/2004(H5N1))
  • Gene Name : HA from Influenza A virus (A/Viet Nam/1203/2004(H5N1))
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Viet Nam/1203/2004(H5N1))
  • VO ID : VO_0011138
  • NCBI Protein GI : 159144921
  • 3D structure: PDB ID : 2FK0
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 284218
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin
  • Protein pI : 6.45
  • Protein Weight : 61425.16
  • Protein Length : 649
  • Protein Note : Haemagglutinin; pfam00509
  • Protein Sequence : Show Sequence
    >ABW90135.1 hemagglutinin [Influenza A virus (A/Viet Nam/1203/2004(H5N1))]
    MEKIVLLFAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKKHNGKLCDLDGVKPLILRD
    CSVAGWLLGNPMCDEFINVPEWSYIVEKANPVNDLCYPGDFNDYEELKHLLSRINHFEKIQIIPKSSWSS
    HEASLGVSSACPYQGKSSFFRNVVWLINKNSTYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTKLYQNP
    TTYISVGTSTLNQRLVPRIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKGDSTI
    MKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQRETRGLFGAIAG
    FIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIE
    NLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNEC
    MESVRNGTYDYPQYSEEARLKREEISGVKLESIGIYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQC
    RICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Researchers evaluated the immunogenicity and efficacy of a panel of flagellin-based hemagglutinin (HA) globular head fusion vaccines in inbred mice. The HA globular head of these vaccines was derived from the A/Vietnam/1203/04 (VN04; H5N1) HA molecule. Results show that replacement of domain D3 of flagellin with the VN04 HA globular head creates a highly effective vaccine that elicits protective HAI titers which protect mice against disease and death in a lethal challenge model with H5 VN virus (Song et al., 2009).
  • Related Vaccine(s): Avian influenza virus DNA vaccine pH5HA , BV-H5/H7/H9 , dVV-HA5(H5N1) , Flagellin-based HA globular head fusion vaccine using HA protein from Influenza A virus (A/Viet Nam/1203/2004(H5N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.227
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
33. HA from Influenza A virus (A/WSN/1933(H1N1))
  • Gene Name : HA from Influenza A virus (A/WSN/1933(H1N1))
  • Sequence Strain (Species/Organism) : Influenza A virus (A/WSN/1933(H1N1))
  • VO ID : VO_0011113
  • NCBI Protein GI : 324200
  • Other Database IDs : CDD:278910
  • Taxonomy ID : 382835
  • Gene Strand (Orientation) : ?
  • Protein Name : hemagglutinin precursor
  • Protein pI : 7.02
  • Protein Weight : 61355.76
  • Protein Length : 650
  • Protein Note : signal peptide
  • Protein Sequence : Show Sequence
    >AAA43209.1 hemagglutinin precursor [Influenza A virus (A/WSN/1933(H1N1))]
    MKAKLLVLLYAFVATDADTICIGYHANNSTDTVDTIFEKNVAVTHSVNLLEDRHNGKLCKLKGIAPLQLG
    KCNITGWLLGNPECDSLLPARSWSYIVETPNSENGACYPGDFIDYEELREQLSSVSSLERFEIFPKESSW
    PNHTFNGVTVSCSHRGKSSFYRNLLWLTKKGDSYPKLTNSYVNNKGKEVLVLWGVHHPSSSDEQQSLYSN
    GNAYVSVASSNYNRRFTPEIAARPKVKDQHGRMNYYWTLLEPGDTIIFEATGNLIAPWYAFALSRGFESG
    IITSNASMHECNTKCQTPQGSINSNLPFQNIHPVTIGECPKYVRSTKLRMVTGLRNIPSIQYRGLFGAIA
    GFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNNLEKRM
    ENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDLNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCDNE
    CMESVRNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFWMCSNGSLQ
    CRICI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A nonpathogenic vector of the cytoplasmic domain of the VSV G protein and expressing influenza virus HA (derived from Influenza A virus (A/WSN/1933(H1N1))) provides complete protection from lethal influenza virus challenge after intranasal administration. A second vector with VSV G deleted and expressing HA (DeltaG-HA) is also protective and nonpathogenic and has the advantage of not inducing neutralizing antibodies to the vector itself (Roberts et al., 1999).
  • Related Vaccine(s): Recombinant vesicular stomatitis virus encoding HA from Influenza A virus (A/WSN/1933(H1N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.438
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
34. M1
  • Gene Name : M1
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Henan/12/2004(H5N1))
  • VO ID : VO_0011136
  • NCBI Protein GI : 61698034
  • Other Database IDs : CDD:278993
    CDD:128998
  • Taxonomy ID : 319102
  • Gene Strand (Orientation) : ?
  • Protein Name : matrix protein 1
  • Protein pI : 9.86
  • Protein Weight : 27345.142
  • Protein Length : 338
  • Protein Note : Influenza Matrix protein (M1); pfam00598
  • Protein Sequence : Show Sequence
    >AAX53515.1 matrix protein 1 [Influenza A virus (A/chicken/Henan/12/2004(H5N1))]
    MSLLTEVETYVLSIIPSGPLKAEIAQKLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPS
    ERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYSTGALASCMGLIYNRMGTVTT
    EVAFGLVCATCEQIADSQHRSHRQMATITNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVANQAR
    QMVQAMRTIGTHPNSSAGLRDNLLENLQAYQKRMGVQMQRFK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Plasmids carrying the HA, NA, NP, M1, and M2 genes, respectively, of the avian influenza virus (AIV) A/Chicken/Henan/12/2004(H5N1) strain were administered to mice, and the mice were challenged with the homologous virus later. The mice immunized with M1 plasmid survived 25% with five immunizations. The mixture of M1 and NP plasmids protected 95% of the mice against the homologous virus, and 80% of the mice against a challenge with heterologous H1N1 (PR8) virus (Chen et al., 2009).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding M1 from Influenza A virus (A/chicken/Henan/12/2004(H5N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.278
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
35. M1
  • Gene Name : M1
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Italy/5093/99(H7N1))
  • NCBI Protein GI : 116247898
  • Other Database IDs : CDD:278993
    CDD:128998
  • Taxonomy ID : 414453
  • Gene Strand (Orientation) : ?
  • Protein Name : matrix protein 1
  • Protein pI : 9.67
  • Protein Weight : 26957.04
  • Protein Length : 338
  • Protein Note : post infection in mouse
  • Protein Sequence : Show Sequence
    >ABJ90262.1 matrix protein 1 [Influenza A virus (A/chicken/Italy/5093/99(H7N1))]
    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPS
    ERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEVALSYSTGALASCMGLIYNRMGTVTT
    EVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQAR
    QMVQAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQRFK
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Avian influenza DNA vaccine pCMV-M
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.391
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
36. M2 from Influenza A virus (A/Puerto Rico/8/34(H1N1))
  • Gene Name : M2 from Influenza A virus (A/Puerto Rico/8/34(H1N1))
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Puerto Rico/8/1934(H1N1))
  • VO ID : VO_0011119
  • NCBI Gene ID : 956528
  • NCBI Protein GI : 56583270
  • Locus Tag : FLUAVs7gp2
  • Genbank Accession : V01099
  • Protein Accession : NP_040979
  • 3D structure: PDB ID : 3BKD
  • Taxonomy ID : 211044
  • Gene Starting Position : 25
  • Gene Ending Position : 1006
  • Gene Strand (Orientation) : +
  • Protein Name : matrix protein 2
  • Protein pI : 5.72
  • Protein Weight : 10647.4
  • Protein Length : 97
  • DNA Sequence : Show Sequence
    >NC_002016.1:25-1006 Influenza A virus (A/Puerto Rico/8/1934(H1N1)) segment 7, complete sequence
    GATGAGTCTTCTAACCGAGGTCGAAACGTACGTTCTCTCTATCATCCCGTCAGGCCCCCTCAAAGCCGAG
    ATCGCACAGAGACTTGAAGATGTCTTTGCAGGGAAGAACACCGATCTTGAGGTTCTCATGGAATGGCTAA
    AGACAAGACCAATCCTGTCACCTCTGACTAAGGGGATTTTAGGATTTGTGTTCACGCTCACCGTGCCCAG
    TGAGCGAGGACTGCAGCGTAGACGCTTTGTCCAAAATGCCCTTAATGGGAACGGGGATCCAAATAACATG
    GACAAAGCAGTTAAACTGTATAGGAAGCTCAAGAGGGAGATAACATTCCATGGGGCCAAAGAAATCTCAC
    TCAGTTATTCTGCTGGTGCACTTGCCAGTTGTATGGGCCTCATATACAACAGGATGGGGGCTGTGACCAC
    TGAAGTGGCATTTGGCCTGGTATGTGCAACCTGTGAACAGATTGCTGACTCCCAGCATCGGTCTCATAGG
    CAAATGGTGACAACAACCAACCCACTAATCAGACATGAGAACAGAATGGTTTTAGCCAGCACTACAGCTA
    AGGCTATGGAGCAAATGGCTGGATCGAGTGAGCAAGCAGCAGAGGCCATGGAGGTTGCTAGTCAGGCTAG
    GCAAATGGTGCAAGCGATGAGAACCATTGGGACTCATCCTAGCTCCAGTGCTGGTCTGAAAAATGATCTT
    CTTGAAAATTTGCAGGCCTATCAGAAACGAATGGGGGTGCAGATGCAACGGTTCAAGTGATCCTCTCGCT
    ATTGCCGCAAATATCATTGGGATCTTGCACTTGATATTGTGGATTCTTGATCGTCTTTTTTTCAAATGCA
    TTTACCGTCGCTTTAAATACGGACTGAAAGGAGGGCCTTCTACGGAAGGAGTGCCAAAGTCTATGAGGGA
    AGAATATCGAAAGGAACAGCAGAGTGCTGTGGATGCTGACGATGGTCATTTTGTCAGCATAGAGCTGGAG
    TA
    
    
  • Protein Sequence : Show Sequence
    >NP_040979.2 matrix protein 2 [Influenza A virus (A/Puerto Rico/8/1934(H1N1))]
    MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDRLFFKCIYRRFKYGLKGGPSTEGVPK
    SMREEYRKEQQSAVDADDGHFVSIELE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A targeted fusion protein based on the CTA1-DD adjuvant and containing tandem repeats of the matrix protein 2 (M2e) ectodomain epitope derived from Influenza A virus (A/Puerto Rico/8/34(H1N1)), CTA1-3M2e-DD, confers strong protective immunity against a potentially lethal challenge infection with influenza virus in mice. The formulation was highly effective for mucosal immunizations and promoted high M2e-specific serum IgG and mucosal IgA antibody titers and an hitherto unknown anti-M2e CD4 T cell immunity (Eliasson et al., 2008).
  • Additional Molecule Role : Virmugen
  • Additional Molecule Role Annotation : Mutant influenza virus that lacks the transmembrane and cytoplasmic tail domains of M2 (M2 knockout [M2KO]) from Influenza A virus (A/Puerto Rico/8/34(H1N1)) is attenuated in both cell culture and mice. Mice intranasally vaccinated with M2KO virus developed protective immune responses and survived a lethal challenge with the wild-type virus, suggesting that the M2KO virus has potential as a live attenuated vaccine (Watanabe et al., 2009).
  • Related Vaccine(s): BPZE1- FHA (H1N1/PR8 influenza A virus) , Influenza virus CTA1-3M2e-DD protein vaccine , Influenza virus DNA vaccine M2-DNA/M2-Ad , Influenza virus DNA vaccine pDNA encoding M2 and NP , M2 mutant from Influenza A
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.108
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
37. NA
  • Gene Name : NA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Aichi/2/1968(H3N2))
  • VO ID : VO_0011123
  • NCBI Protein GI : 46401580
  • Other Database IDs : CDD:271235
  • Taxonomy ID : 387139
  • Gene Strand (Orientation) : ?
  • Protein Name : neuraminidase
  • Protein pI : 6.7
  • Protein Weight : 49574.86
  • Protein Length : 546
  • Protein Note : synonym: Influenza A virus (A/Aichi/2/68(H3N2))
  • Protein Sequence : Show Sequence
    >BAD16642.1 neuraminidase [Influenza A virus (A/Aichi/2/1968(H3N2))]
    MNPNQKIITIGSVSLTIATVCFLMQIAILVTTVTLHFKQYECDSPASNQVMPCEPIIIERNITEIVYLNN
    TTIDKEKCPKVVEYRNWSKPQCQITGFAPFSKDNSIRLSAGGDIWVTREPYVSCDHGKCYQFALGQGTTL
    DNKHSNDTIHDRIPHRTLLMNELGVPFHLGTRQVCIAWSSSSCHDGKAWLHVCITGDDKNATASFIYDGR
    LVDSIGSWSQNILRTQESECVCINGTCTVVMTDGSASGRADTRILFIEEGKIVHISPLSGSAQHVEECSC
    YPRYPGVRCICRDNWKGSNRPVVDINMEDYSIDSSYVCSGLVGDTPRNDDRSSNSNCRNPNNERGNQGVK
    GWAFDNGDDVWMGRTISKDLRSGYETFKVIGGWSTPNSKSQINRQVIVDSDNRSGYSGIFSVEGKSCINR
    CFYVELIRGRKQETRVWWTSNSIVVFCGTSGTYGTGSWPDGANINFMPI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The protective effect of neuraminidase (NA) was studied in a mouse protection test using isolated neuraminidase of A2/Aichi/68(H3N2) virus and the complete recombinant virus A/eq(Heq-1)-HK(N2) as antigens. Immunized mice were protected against A2/Aichi(H3N2) challenge virus; however, the protection rate was low in comparison to animals immunized with comparable amounts of the complete A2/68(H3N2) virus9 (Reichert and Mauler, 1975).
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.499
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
38. NA
  • Gene Name : NA
  • Sequence Strain (Species/Organism) : Influenza B virus (B/Ibaraki/2/85)
  • VO ID : VO_0011129
  • NCBI Protein GI : 53829726
  • Other Database IDs : CDD:278493
  • Taxonomy ID : 107411
  • Gene Strand (Orientation) : ?
  • Protein Name : NA glycoprotein
  • Protein pI : 7.54
  • Protein Weight : 50164.23
  • Protein Length : 538
  • Protein Note : Neuraminidase; pfam00064
  • Protein Sequence : Show Sequence
    >AAU94751.1 NA glycoprotein [Influenza B virus (B/Ibaraki/2/85)]
    MLPSTIQTLTLFLTSGGVLLSLYVSASLSYLLYSDILLKFSPKITAPTMTLDCANASNVQAVNRSATKEM
    TFLLPEPEWTYPRLSCQGSTFQKALLISPHRFGEARGNSAPLIIREPFIACGPKECKHFALTHYAAQPGG
    YYNGTREDRNKLRHLISVKLGKIPTVENSIFHMAAWSGSACHDGREWTYIGVDGPDSNALIKIKYGEAYT
    DTYHSYANNILRTQESACNCIGGDCYLMITDGSASGISKCRFLKIREGRIIKEIFPTGRVEHTEECTCGF
    ASNKTIECACRDNNYTAKRPFVKLNVETDTAEIRLMCTETYLDTPRPDDGSITGPCESNGDKGRGGIKGG
    FVHQRMASKIGRWYSRTMSKTERMGMELYVKYDGDPWTDSDALAPSGVMVSMKEPGWYSFGFEIKDKKCD
    VPCIGIEMVHDGGKKTWHSAATAIYCLMGSGQLLWDTVTGVDMAL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protection against a lethal influenza B virus infection was examined in BALB/c mice immunized with plasmid DNAs encoding hemagglutinin (HA), neuraminidase (NA and NB) and nucleoprotein (NP) from the B/Ibaraki/2/85 virus. Both HA and NA DNAs conferred complete protection against the lethal challenge in all the tested mouse strains (Chen et al., 2001).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding NA from Influenza B virus (B/Ibaraki/2/85)
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.420
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
39. NA
  • Gene Name : NA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Henan/12/2004(H5N1))
  • VO ID : VO_0011135
  • NCBI Protein GI : 61698053
  • 3D structure: PDB ID : 2HTY
  • Other Database IDs : CDD:271235
  • Taxonomy ID : 319102
  • Gene Strand (Orientation) : ?
  • Protein Name : neuraminidase
  • Protein pI : 6.62
  • Protein Weight : 46889.862
  • Protein Length : 535
  • Protein Note : Sialidase or neuraminidase (EC 3.2.1.18) of Influenza viruses A and B; cd15483
  • Protein Sequence : Show Sequence
    >AAX53527.1 neuraminidase [Influenza A virus (A/chicken/Henan/12/2004(H5N1))]
    MNPNQKIITIGSICMVIGIVSLMLQIGNMISIWVSHSIQTGNQHQAEPISNTNFLTEKAVASVTLAGNSS
    LCPISGWAVHSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMS
    CPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESE
    CACVNGSCFTVMTDGPSNGQASYKIFKMEKGKVVKSVELEAPNYHYEECSCYPDAGEITCVCRDNWHGSN
    RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPNGAYGVKGFSFKYGNGVWIGRTKSTNSRSG
    FEMIWDPNGWTGTDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSG
    SSISFCGVNSDTVGWSWPDGAELPFTIDK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Plasmids carrying the HA, NA, NP, M1, and M2 genes, respectively, of the avian influenza virus (AIV) A/Chicken/Henan/12/2004(H5N1) strain were administered to mice, and the mice were challenged with the homologous virus later. The mice immunized with HA plasmid once and the NA plasmid twice survived 100% (Chen et al., 2009).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding NA from Influenza A virus (A/chicken/Henan/12/2004(H5N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.763
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
40. NA
  • Gene Name : NA
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Viet Nam/1203/2004(H5N1))
  • NCBI Protein GI : 291359313
  • Other Database IDs : CDD:271235
  • Taxonomy ID : 284218
  • Gene Strand (Orientation) : ?
  • Protein Name : neuraminidase
  • Protein pI : 6.49
  • Protein Weight : 47025.1
  • Protein Length : 532
  • Protein Note : Sialidase or neuraminidase (EC 3.2.1.18) of Influenza viruses A and B; cd15483
  • Protein Sequence : Show Sequence
    >ADD97097.1 neuraminidase [Influenza A virus (A/Viet Nam/1203/2004(H5N1))]
    MNPNQKIITIGSICMVTGIVSLMLQIGNMISIWVSHSIHTGNQHQSEPISNTNFLTEKAVASVKLAGNSS
    LCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMS
    CPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESE
    CACVNGSCFTVMTDGPSNGQASHKIFKMEKGKVVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSN
    RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSG
    FEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSG
    SSISFCGVNSDTVGWSWPDGAELPFTIDK
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Avian influenza virus DNA vaccine pN1NA encoding N1 neuraminidase
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.780
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
41. NA from A/Puerto Rico/8/1934(H1N1)
  • Gene Name : NA from A/Puerto Rico/8/1934(H1N1)
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Puerto Rico/8/1934(H1N1))
  • NCBI Gene ID : 956530
  • NCBI Protein GI : 8486128
  • Locus Tag : FLUAVs6gp1
  • Genbank Accession : J02146
  • Protein Accession : NP_040981
  • Taxonomy ID : 211044
  • Gene Starting Position : 20
  • Gene Ending Position : 1384
  • Gene Strand (Orientation) : +
  • Protein Name : neuraminidase
  • Protein pI : 7.51
  • Protein Weight : 47364.16
  • Protein Length : 454
  • DNA Sequence : Show Sequence
    >NC_002018.1:20-1384 Influenza A virus (A/Puerto Rico/8/1934(H1N1)) segment 6, complete sequence
    AATGAATCCAAATCAGAAAATAATAACCATTGGATCAATCTGTCTGGTAGTCGGACTAATTAGCCTAATA
    TTGCAAATAGGGAATATAATCTCAATATGGATTAGCCATTCAATTCAAACTGGAAGTCAAAACCATACTG
    GAATATGCAACCAAAACATCATTACCTATAAAAATAGCACCTGGGTAAAGGACACAACTTCAGTGATATT
    AACCGGCAATTCATCTCTTTGTCCCATCCGTGGGTGGGCTATATACAGCAAAGACAATAGCATAAGAATT
    GGTTCCAAAGGAGACGTTTTTGTCATAAGAGAGCCCTTTATTTCATGTTCTCACTTGGAATGCAGGACCT
    TTTTTCTGACCCAAGGTGCCTTACTGAATGACAGGCATTCAAATGGGACTGTTAAGGACAGAAGCCCTTA
    TAGGGCCTTAATGAGCTGCCCTGTCGGTGAAGCTCCGTCCCCGTACAATTCAAGATTTGAATCGGTTGCT
    TGGTCAGCAAGTGCATGTCATGATGGCATGGGCTGGCTAACAATCGGAATTTCAGGTCCAGATAATGGAG
    CAGTGGCTGTATTAAAATACAACGGCATAATAACTGAAACCATAAAAAGTTGGAGGAAGAAAATATTGAG
    GACACAAGAGTCTGAATGTGCCTGTGTAAATGGTTCATGTTTTACTATAATGACTGATGGCCCGAGTGAT
    GGGCTGGCCTCGTACAAAATTTTCAAGATCGAAAAGGGGAAGGTTACTAAATCAATAGAGTTGAATGCAC
    CTAATTCTCACTATGAGGAATGTTCCTGTTACCCTGATACCGGCAAAGTGATGTGTGTGTGCAGAGACAA
    TTGGCATGGTTCGAACCGGCCATGGGTGTCTTTCGATCAAAACCTGGATTATCAAATAGGATACATCTGC
    AGTGGGGTTTTCGGTGACAACCCGCGTCCCAAAGATGGAACAGGCAGCTGTGGTCCAGTGTATGTTGATG
    GAGCAAACGGAGTAAAGGGATTTTCATATAGGTATGGTAATGGTGTTTGGATAGGAAGGACCAAAAGTCA
    CAGTTCCAGACATGGGTTTGAGATGATTTGGGATCCTAATGGATGGACAGAGACTGATAGTAAGTTCTCT
    GTGAGGCAAGATGTTGTGGCAATGACTGATTGGTCAGGGTATAGCGGGAGTTTCGTTCAACATCCTGAGC
    TAACAGGGCTAGACTGTATAAGGCCGTGCTTCTGGGTTGAATTAATCAGGGGACGACCTAAAGAAAAAAC
    AATCTGGACTAGTGCGAGCAGCATTTCTTTTTGTGGCGTGAATAGTGATACTGTAGATTGGTCTTGGCCA
    GACGGTGCTGAGTTGCCATTCACCATTGACAAGTA
    
    
  • Protein Sequence : Show Sequence
    >NP_040981.1 neuraminidase [Influenza A virus (A/Puerto Rico/8/1934(H1N1))]
    MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVIL
    TGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDRHSNGTVKDRSPY
    RALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILR
    TQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDN
    WHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPKDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSH
    SSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKEKT
    IWTSASSISFCGVNSDTVDWSWPDGAELPFTIDK
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Influenza virus DNA vaccine NA-DNA , Influenza virus DNA vaccine pIRES/HA/IL-12p35 + pIRES/NA/IL-12p40 , Influenza virus DNA vaccine pIRES/NA expressing NA , Influenza virus DNA vaccine pIRES/NA/GM-CSF encoding NA , Influenza virus DNA vaccine pIRES/NA/IL-2 encoding NA
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.568
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
42. NP
  • Gene Name : NP
  • Sequence Strain (Species/Organism) : Influenza A virus H3N2
  • VO ID : VO_0011111
  • NCBI Protein GI : 3722159
  • Other Database IDs : CDD:278907
  • Taxonomy ID : 41857
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleoprotein
  • Protein pI : 9.57
  • Protein Weight : 54706.76
  • Protein Length : 558
  • Protein Note : Influenza virus nucleoprotein; pfam00506
  • Protein Sequence : Show Sequence
    >AAC63462.1 nucleoprotein [Influenza A virus H3N2]
    MASQGTKRSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSA
    FDERRNRYLEEHPSAGKDPKKTGGPIYKRVDGRWMRELVLYDKEEIRRIWRQANNGDDATAGLTHMMIWH
    SNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGIGTMVMELIRMIKRGINDRNFWRGE
    NGRKTRSAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFSARSALILRGSVAHKSCLPACV
    YGPAVSSGYNFEKEGYSLVGIDPFKLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRLLSFIRGT
    KVSPRGKLSTRGVQIASNENMDNMESSTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF
    EKSTVMAAFTGNTEGRTSDMRAEIIRMMEGAKPEEVSFRGRGVFELSDEKATNPIVPSFDMSNEGSYFFG
    DNAEEYDN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : BALB/c mice were immunized intranasally with an adjuvant (cholera toxin B subunit containing 0.2% of the whole toxin)-combined with A or B virus recombinant NP. The NP-immune mice, when challenged intranasally with a sublethal dose of the virus 3 wk after immunization, had accelerated virus clearance from the nasal site in both an influenza type-specific and a nonspecific manner, as shown by the protection from high morbidity from the second day after challenge (Tamura et al., 1996).
  • Related Vaccine(s): Influenza virus DNA vaccine d1TTFC-NP encoding NP
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.104
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
43. NP
  • Gene Name : NP
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Henan/12/2004(H5N1))
  • VO ID : VO_0011134
  • NCBI Protein GI : 61698066
  • Other Database IDs : CDD:278907
  • Taxonomy ID : 319102
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleocapsid protein
  • Protein pI : 9.73
  • Protein Weight : 54851.512
  • Protein Length : 592
  • Protein Note : Influenza virus nucleoprotein; pfam00506
  • Protein Sequence : Show Sequence
    >AAX53533.1 nucleocapsid protein [Influenza A virus (A/chicken/Henan/12/2004(H5N1))]
    MASQGTKRSYEQMETGGERQNATEIRASVGRMVSGIGRFYIQMCTELKLSDYEGRLIQNSITIERMVLSA
    FDERRNRYLEEHPSAGKDPKKTGGPIYRRRDGKWVRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWH
    SNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGE
    NGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACV
    YGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGT
    RVVPRGQLSTRGVQIASNENMEAMDSNTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF
    ERATIMAAFTGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKATNPIVPSFDMNNEGSYFFG
    DNAEEYDN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Plasmids carrying the HA, NA, NP, M1, and M2 genes, respectively, of the avian influenza virus (AIV) A/Chicken/Henan/12/2004(H5N1) strain were administered to mice, and the mice were challenged with the homologous virus later. The mice immunized with NP plasmid showed 60-80% survival rate with at least three immunizations. The mixture of M1 and NP plasmids protected 95% of the mice against the homologous virus, and 80% of the mice against a challenge with heterologous H1N1 (PR8) virus (Chen et al., 2009).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding NP from Influenza A virus (A/chicken/Henan/12/2004(H5N1))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.101
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
44. NP
  • Gene Name : NP
  • Sequence Strain (Species/Organism) : Influenza A virus (A/chicken/Hubei/489/2004(H5N1))
  • VO ID : VO_0011137
  • NCBI Protein GI : 55233233
  • Other Database IDs : CDD:278907
  • Taxonomy ID : 298603
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleoprotein
  • Protein pI : 9.66
  • Protein Weight : 54661.59
  • Protein Length : 586
  • Protein Note : Influenza virus nucleoprotein; pfam00506
  • Protein Sequence : Show Sequence
    >AAV48549.1 nucleoprotein [Influenza A virus (A/chicken/Hubei/489/2004(H5N1))]
    MASQGTKRSYEQMETGGERQNATEIRASVGRMVSGIGRFYIQMCTELKLSDYEGRLIQNSITIERMVLSA
    FDERRNRYLEEHPSAGKDPKKTGGPIYRRRDGKWVRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWH
    SNLDDATSQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGE
    NGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACV
    YGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGT
    RVVPRGQLSTRGVQIASNENMEAMDSNTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF
    ERATIMAAFTGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKATNPIVPSFDMNNEGSYFFG
    DNAEEYDN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Vaccination with ptPAs/NP derived from Influenza A virus (A/chicken/Hubei/489/2004(H5N1)) efficiently cleared the homologous H5N1 influenza virus in the infected lungs and induced partial cross-protection against heterologous, highly pathogenic H5N1 strains in mice (Luo et al., 2008).
  • Related Vaccine(s): Influenza virus DNA vaccine encoding NP from Influenza A virus (A/chicken/Hubei/489/2004(H5N1)) , Influenza virus DNA vaccine pHA/NP147–155 encoding NP147-155
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.112
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
45. NP
  • Gene Name : NP
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Hong Kong/156/97(H5N1))
  • NCBI Protein GI : 12038906
  • Other Database IDs : CDD:278907
    GOA:O92784
    InterPro: IPR002141
    UniProtKB/UniProt: O92784
  • Taxonomy ID : 130763
  • Gene Strand (Orientation) : ?
  • Protein Name : Nucleoprotein
  • Protein pI : 9.84
  • Protein Weight : 55078.23
  • Protein Length : 580
  • Protein Note : Influenza virus nucleoprotein; pfam00506
  • Protein Sequence : Show Sequence
    >CAC19704.1 Nucleoprotein [Influenza A virus (A/Hong Kong/156/97(H5N1))]
    MASQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMCTELKLSDQEGRLIQNSITIERMVLSA
    FDERRNRYLEEHPSAGKDPKKTGGPIYRRRDGKWVRELILYDKEEIRRIWRQANNGEDATAGLTHMMIWH
    SNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAIKGVGTMVMELIRMIKRGINDRNFWRGE
    NGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACV
    YGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPKENPAHKSQLVWMACHSAAFEDLRVSSFIRGT
    RVIPRGQLSTRGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF
    ERVTIMAAFKGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFG
    DNAEEYDN
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Influenza virus DNA vaccine A/NP
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.099
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
46. NP
  • Gene Name : NP
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Vietnam/CL36/2004(H5N1))
  • NCBI Protein GI : 93008749
  • Other Database IDs : CDD:278907
  • Taxonomy ID : 357209
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleoprotein
  • Protein pI : 9.67
  • Protein Weight : 54481.51
  • Protein Length : 587
  • Protein Note : Influenza virus nucleoprotein; pfam00506
  • Protein Sequence : Show Sequence
    >ABE97805.1 nucleoprotein, partial [Influenza A virus (A/Vietnam/CL36/2004(H5N1))]
    MASQGTKRSYEQMETGGERQNATEIRASVGRMVSGIGRFYIQMCTELKLSDYEGRLIQNSITIERMVLSA
    FDERRNRYLEEHPSAGKDPKKTGGPIYRRRDGKWVRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWH
    SNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGE
    NGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACV
    YGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGT
    RVVPRGQLSTRGVQIASNENMEAMDSNTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF
    ERATIMAAFTGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKATNPIVPSFDMNNEGSYFFG
    DNAEE
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Avian influenza virus DNA vaccine pNP
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.103
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
47. NP
  • Gene Name : NP
  • Sequence Strain (Species/Organism) : Influenza A virus (A/turkey/Ireland/1378/1983(H5N8))
  • NCBI Protein GI : 115279340
  • Other Database IDs : CDD:278907
  • Taxonomy ID : 380285
  • Gene Strand (Orientation) : ?
  • Protein Name : nucleocapsid protein
  • Protein pI : 9.73
  • Protein Weight : 54803.95
  • Protein Length : 595
  • Protein Note : Influenza virus nucleoprotein; pfam00506
  • Protein Sequence : Show Sequence
    >ABI85121.1 nucleocapsid protein [Influenza A virus (A/turkey/Ireland/1378/1983(H5N8))]
    MASQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMCTELKLSDYEGRLIQNSITIERMVLSA
    FDERRNKYLEEHPSAGKDPKKTGGPIYRRRDGKWMRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWH
    SNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGIGTMVMELIRMIKRGINDRNFWRGE
    NGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACV
    YGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGT
    RVVPRGQLSTRGVQIASNENMETMDSSTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF
    ERATIMAAFTGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFG
    DNAEEYDN
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.116
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
48. NP from Influenza A virus (A/nt/60/1968(H3N2))
  • Gene Name : NP from Influenza A virus (A/nt/60/1968(H3N2))
  • Sequence Strain (Species/Organism) : Influenza A virus (A/nt/60/1968(H3N2))
  • VO ID : VO_0011264
  • NCBI Protein GI : 324704
  • Other Database IDs : CDD:278907
  • Taxonomy ID : 384505
  • Protein Name : nucleoprotein
  • Protein pI : 9.55
  • Protein Weight : 54488.67
  • Protein Length : 574
  • Protein Note : Influenza virus nucleoprotein; pfam00506
  • Protein Sequence : Show Sequence
    >AAA43465.1 nucleoprotein [Influenza A virus (A/nt/60/1968(H3N2))]
    MASQGTKRSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSA
    FDERRNKYLEEHPSAGKDPKKTGGPIYKRVDGKWMRELVLYDKGEIRRIWRQANNGDDATAGLTHMMIWH
    SNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGE
    NGRKTRSAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACV
    YGPAVASGYDFEKEGYSLVGIDPFKLLQNSQVYSLIRPNENPAHKSQLVWMACNSAAFEDLRVLSFIRGT
    KVSPRGKLSTRGVQIASNENMDAMESSTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPAFSVQRNLPF
    DKPTIMAAFTGNTEGRTSDMRAEIIRMMEGAKPEEMSFQGRGVFELSDEKAANPIVPSFDMSNEGSYFFG
    DNAEEYDN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized with Recombinant-derived nucleoprotein (rNP) from S. typhimurium expressing the cloned NP gene from A/NT/60/68 (Jones & Brownlee, 1985) were protected against a lethal challenge with Influenza A/Puerto Rico/8/34 (A/PR8) virus but showed considerable morbidity before recovery (Tite et al., 1990).
  • Related Vaccine(s): Influenza virus NP protein vaccine (Influenza A virus (A/nt/60/1968(H3N2)))
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.110
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
49. NP from Influenza A virus (A/Puerto Rico/8/34(H1N1))
  • Gene Name : NP from Influenza A virus (A/Puerto Rico/8/34(H1N1))
  • Sequence Strain (Species/Organism) : Influenza A virus (A/Puerto Rico/8/1934(H1N1))
  • VO ID : VO_0011122
  • NCBI Gene ID : 956531
  • NCBI Protein GI : 8486130
  • Locus Tag : FLUAVs5gp1
  • Genbank Accession : J02147
  • Protein Accession : NP_040982
  • Taxonomy ID : 211044
  • Gene Starting Position : 45
  • Gene Ending Position : 1541
  • Gene Strand (Orientation) : +
  • Protein Name : nucleoprotein
  • Protein pI : 9.56
  • Protein Weight : 53786.92
  • Protein Length : 498
  • DNA Sequence : Show Sequence
    >NC_002019.1:45-1541 Influenza A virus (A/Puerto Rico/8/1934(H1N1)) segment 5, complete sequence
    CATGGCGTCCCAAGGCACCAAACGGTCTTACGAACAGATGGAGACTGATGGAGAACGCCAGAATGCCACT
    GAAATCAGAGCATCCGTCGGAAAAATGATTGGTGGAATTGGACGATTCTACATCCAAATGTGCACAGAAC
    TTAAACTCAGTGATTATGAGGGACGGTTGATCCAAAACAGCTTAACAATAGAGAGAATGGTGCTCTCTGC
    TTTTGACGAAAGGAGAAATAAATACCTGGAAGAACATCCCAGTGCGGGGAAGGATCCTAAGAAAACTGGA
    GGACCTATATACAGAAGAGTAAACGGAAAGTGGATGAGAGAACTCATCCTTTATGACAAAGAAGAAATAA
    GGCGAATCTGGCGCCAAGCTAATAATGGTGACGATGCAACGGCTGGTCTGACTCACATGATGATCTGGCA
    TTCCAATTTGAATGATGCAACTTATCAGAGGACAAGGGCTCTTGTTCGCACCGGAATGGATCCCAGGATG
    TGCTCTCTGATGCAAGGTTCAACTCTCCCTAGGAGGTCTGGAGCCGCAGGTGCTGCAGTCAAAGGAGTTG
    GAACAATGGTGATGGAATTGGTCAGGATGATCAAACGTGGGATCAATGATCGGAACTTCTGGAGGGGTGA
    GAATGGACGAAAAACAAGAATTGCTTATGAAAGAATGTGCAACATTCTCAAAGGGAAATTTCAAACTGCT
    GCACAAAAAGCAATGATGGATCAAGTGAGAGAGAGCCGGGACCCAGGGAATGCTGAGTTCGAAGATCTCA
    CTTTTCTAGCACGGTCTGCACTCATATTGAGAGGGTCGGTTGCTCACAAGTCCTGCCTGCCTGCCTGTGT
    GTATGGACCTGCCGTAGCCAGTGGGTACGACTTTGAAAGAGAGGGATACTCTCTAGTCGGAATAGACCCT
    TTCAGACTGCTTCAAAACAGCCAAGTGTACAGCCTAATCAGACCAAATGAGAATCCAGCACACAAGAGTC
    AACTGGTGTGGATGGCATGCCATTCTGCCGCATTTGAAGATCTAAGAGTATTGAGCTTCATCAAAGGGAC
    GAAGGTGGTCCCAAGAGGGAAGCTTTCCACTAGAGGAGTTCAAATTGCTTCCAATGAAAATATGGAGACT
    ATGGAATCAAGTACACTTGAACTGAGAAGCAGGTACTGGGCCATAAGGACCAGAAGTGGAGGAAACACCA
    ATCAACAGAGGGCATCTGCGGGCCAAATCAGCATACAACCTACGTTCTCAGTACAGAGAAATCTCCCTTT
    TGACAGAACAACCGTTATGGCAGCATTCACTGGGAATACAGAGGGGAGAACATCTGACATGAGGACCGAA
    ATCATAAGGATGATGGAAAGTGCAAGACCAGAAGATGTGTCTTTCCAGGGGCGGGGAGTCTTCGAGCTCT
    CGGACGAAAAGGCAGCGAGCCCGATCGTGCCTTCCTTTGACATGAGTAATGAAGGATCTTATTTCTTCGG
    AGACAATGCAGAGGAGTACGACAATTA
    
    
  • Protein Sequence : Show Sequence
    >NP_040982.1 nucleoprotein [Influenza A virus (A/Puerto Rico/8/1934(H1N1))]
    MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSA
    FDERRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWH
    SNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRGINDRNFWRGE
    NGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESRDPGNAEFEDLTFLARSALILRGSVAHKSCLPACV
    YGPAVASGYDFEREGYSLVGIDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVLSFIKGT
    KVVPRGKLSTRGVQIASNENMETMESSTLELRSRYWAIRTRSGGNTNQQRASAGQISIQPTFSVQRNLPF
    DRTTVMAAFTGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKAASPIVPSFDMSNEGSYFFG
    DNAEEYDN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A simian adenovirus 24 (AdC7) vector expressing the influenza A/Puerto Rico/8/34 NP was tested for its efficacy in protecting BALB/c mice against two H5N1 strains. When tested in a mouse challenge model, there was a significantly improved survival rate following challenge with the Vietnam/1203/04 strain of H5N1 that has caused human outbreaks (Roy et al., 2007).
  • Related Vaccine(s): AdH5-FluA NP , Influenza virus DNA vaccine NP DNA , Influenza virus DNA vaccine pBK-SFV-NP , Influenza virus DNA vaccine pDNA encoding M2 and NP , Influenza virus DNA vaccine pRSV-NP encoding the coding sequence from influenza virus A/PR/8/34.
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.087
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
50. NP from Influenza B virus
  • Gene Name : NP from Influenza B virus
  • Sequence Strain (Species/Organism) : Influenza B virus
  • VO ID : VO_0011110
  • NCBI Gene ID : 956539
  • NCBI Protein GI : 8486155
  • Locus Tag : FLUBVsRNA-5gp1
  • Genbank Accession : K01395
  • Protein Accession : NP_056661
  • Taxonomy ID : 11520
  • Segment No : RNA 5
  • Gene Starting Position : 57
  • Gene Ending Position : 1739
  • Gene Strand (Orientation) : +
  • Protein Name : nucleoprotein
  • Protein pI : 9.94
  • Protein Weight : 58594.17
  • Protein Length : 560
  • DNA Sequence : Show Sequence
    >NC_002208.1:57-1739 Influenza B virus (B/Lee/1940) segment 5, complete sequence
    AATGTCCAACATGGATATTGACAGTATAAATACCGGAACAATCGATAAAACACCAGAAGAACTGACTCCC
    GGAACCAGTGGGGCAACCAGACCAATCATCAAGCCAGCAACCCTTGCTCCGCCAAGCAACAAACGAACCC
    GAAATCCATCTCCAGAAAGGACAACCACAAGCAGTGAAACCGATATCGGAAGGAAAATCCAAAAGAAACA
    AACCCCAACAGAGATAAAGAAGAGCGTCTACAAAATGGTGGTAAAACTGGGTGAATTCTACAACCAGATG
    ATGGTCAAAGCTGGACTTAATGATGACATGGAAAGGAATCTAATTCAAAATGCACAAGCTGTGGAGAGAA
    TCCTATTGGCTGCAACTGATGACAAGAAAACTGAATACCAAAAGAAAAGGAATGCCAGAGATGTCAAAGA
    AGGGAAGGAAGAAATAGACCACAACAAGACAGGAGGCACCTTTTATAAGATGGTAAGAGATGATAAAACC
    ATCTACTTCAGCCCTATAAAAATTACCTTTTTAAAAGAAGAGGTGAAAACAATGTACAAGACCACCATGG
    GGAGTGATGGTTTCAGTGGACTAAATCACATTATGATTGGACATTCACAGATGAACGATGTCTGTTTCCA
    AAGATCAAAGGGACTGAAAAGGGTTGGACTTGACCCTTCATTAATCAGTACTTTTGCCGGAAGCACACTA
    CCCAGAAGATCAGGTACAACTGGTGTTGCAATCAAAGGAGGTGGAACTTTAGTGGATGAAGCCATCCGAT
    TTATAGGAAGAGCAATGGCAGACAGAGGGCTACTGAGAGACATCAAGGCCAAGACGGCCTATGAAAAGAT
    TCTTCTGAATCTGAAAAACAAGTGCTCTGCGCCGCAACAAAAGGCTCTAGTTGATCAAGTGATCGGAAGT
    AGGAACCCAGGGATTGCAGACATAGAAGACCTAACTCTGCTTGCCAGAAGCATGGTAGTTGTCAGACCCT
    CTGTAGCGAGCAAAGTGGTGCTTCCCATAAGCATTTATGCTAAAATACCTCAACTAGGATTCAATACCGA
    AGAATACTCTATGGTTGGGTATGAAGCCATGGCTCTTTATAATATGGCAACACCTGTTTCCATATTAAGA
    ATGGGAGATGACGCAAAAGATAAATCTCAACTATTCTTCATGTCGTGCTTCGGAGCTGCCTATGAAGATC
    TAAGAGTGTTATCTGCACTAACGGGCACCGAATTTAAGCCTAGATCAGCACTAAAATGCAAGGGTTTCCA
    TGTCCCGGCTAAGGAGCAAGTAGAAGGAATGGGGGCAGCTCTGATGTCCATCAAGCTTCAGTTCTGGGCC
    CCAATGACCAGATCTGGAGGGAATGAAGTAAGTGGAGAAGGAGGGTCTGGTCAAATAAGTTGCAGCCCTG
    TGTTTGCAGTAGAAAGACCTATTGCTCTAAGCAAGCAAGCTGTAAGAAGAATGCTGTCAATGAACGTTGA
    AGGACGTGATGCAGATGTCAAAGGAAATCTACTCAAAATGATGAATGATTCAATGGCAAAGAAAACCAGT
    GGAAATGCTTTCATTGGGAAGAAAATGTTTCAAATATCAGACAAAAACAAAGTCAATCCCATTGAGATTC
    CAATTAAGCAGACCATCCCCAATTTCTTCTTTGGGAGGGACACAGCAGAGGATTATGATGACCTCGATTA
    TTA
    
    
  • Protein Sequence : Show Sequence
    >NP_056661.1 nucleoprotein [Influenza B virus (B/Lee/1940)]
    MSNMDIDSINTGTIDKTPEELTPGTSGATRPIIKPATLAPPSNKRTRNPSPERTTTSSETDIGRKIQKKQ
    TPTEIKKSVYKMVVKLGEFYNQMMVKAGLNDDMERNLIQNAQAVERILLAATDDKKTEYQKKRNARDVKE
    GKEEIDHNKTGGTFYKMVRDDKTIYFSPIKITFLKEEVKTMYKTTMGSDGFSGLNHIMIGHSQMNDVCFQ
    RSKGLKRVGLDPSLISTFAGSTLPRRSGTTGVAIKGGGTLVDEAIRFIGRAMADRGLLRDIKAKTAYEKI
    LLNLKNKCSAPQQKALVDQVIGSRNPGIADIEDLTLLARSMVVVRPSVASKVVLPISIYAKIPQLGFNTE
    EYSMVGYEAMALYNMATPVSILRMGDDAKDKSQLFFMSCFGAAYEDLRVLSALTGTEFKPRSALKCKGFH
    VPAKEQVEGMGAALMSIKLQFWAPMTRSGGNEVSGEGGSGQISCSPVFAVERPIALSKQAVRRMLSMNVE
    GRDADVKGNLLKMMNDSMAKKTSGNAFIGKKMFQISDKNKVNPIEIPIKQTIPNFFFGRDTAEDYDDLDY
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : BALB/c mice were immunized intranasally with an adjuvant (cholera toxin B subunit containing 0.2% of the whole toxin)-combined with A or B virus recombinant NP. The NP-immune mice, when challenged intranasally with a sublethal dose of the virus 3 wk after immunization, had accelerated virus clearance from the nasal site in both an influenza type-specific and a nonspecific manner, as shown by the protection from high morbidity from the second day after challenge (Tamura et al., 1996).
  • Localization(Probability):
    (Prob.=0)
  • Adhesin Probability: 0.224
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
II. References
1. Abe et al., 2003: Abe T, Takahashi H, Hamazaki H, Miyano-Kurosaki N, Matsuura Y, Takaku H. Baculovirus induces an innate immune response and confers protection from lethal influenza virus infection in mice. Journal of immunology (Baltimore, Md. : 1950). 2003; 171(3); 1133-1139. [PubMed: 12874198].
2. Bright et al., 2008: Bright RA, Carter DM, Crevar CJ, Toapanta FR, Steckbeck JD, Cole KS, Kumar NM, Pushko P, Smith G, Tumpey TM, Ross TM. Cross-clade protective immune responses to influenza viruses with H5N1 HA and NA elicited by an influenza virus-like particle. PloS one. 2008; 3(1); e1501. [PubMed: 18231588].
3. Bublot et al., 2010: Bublot M, Manvell RJ, Shell W, Brown IH. High level of protection induced by two fowlpox vector vaccines against a highly pathogenic avian influenza H5N1 challenge in specific-pathogen-free chickens. Avian diseases. 2010; 54(1 Suppl); 257-261. [PubMed: 20521642].
4. Chen et al., 2001: Chen Z, Kadowaki S, Hagiwara Y, Yoshikawa T, Sata T, Kurata T, Tamura S. Protection against influenza B virus infection by immunization with DNA vaccines. Vaccine. 2001; 19(11-12); 1446-1455. [PubMed: 11163667].
5. Chen et al., 2009: Chen Q, Kuang H, Wang H, Fang F, Yang Z, Zhang Z, Zhang X, Chen Z. Comparing the ability of a series of viral protein-expressing plasmid DNAs to protect against H5N1 influenza virus. Virus genes. 2009; 38(1); 30-38. [PubMed: 19067149].
6. Cox et al., 2009: Cox RJ, Major D, Hauge S, Madhun AS, Brokstad KA, Kuhne M, Smith J, Vogel FR, Zambon M, Haaheim LR, Wood J. A cell-based H7N1 split influenza virion vaccine confers protection in mouse and ferret challenge models. Influenza and other respiratory viruses. 2009; 3(3); 107-117. [PubMed: 19453487].
7. Donnelly et al., 1997: Donnelly JJ, Friedman A, Ulmer JB, Liu MA. Further protection against antigenic drift of influenza virus in a ferret model by DNA vaccination. Vaccine. 1997; 15(8); 865-868. [PubMed: 9234535].
8. Eliasson et al., 2008: Eliasson DG, El Bakkouri K, Schön K, Ramne A, Festjens E, Löwenadler B, Fiers W, Saelens X, Lycke N. CTA1-M2e-DD: a novel mucosal adjuvant targeted influenza vaccine. Vaccine. 2008; 26(9); 1243-1252. [PubMed: 18243429].
9. Ge et al., 2010: Ge J, Tian G, Zeng X, Jiang Y, Chen H, Bua Z. Generation and evaluation of a Newcastle disease virus-based H9 avian influenza live vaccine. Avian diseases. 2010; 54(1 Suppl); 294-296. [PubMed: 20521648].
10. Huber et al., 2006: Huber VC, McKeon RM, Brackin MN, Miller LA, Keating R, Brown SA, Makarova N, Perez DR, Macdonald GH, McCullers JA. Distinct contributions of vaccine-induced immunoglobulin G1 (IgG1) and IgG2a antibodies to protective immunity against influenza. Clinical and vaccine immunology : CVI. 2006; 13(9); 981-990. [PubMed: 16960108].
11. Jiang et al., 2007: Jiang Y, Yu K, Zhang H, Zhang P, Li C, Tian G, Li Y, Wang X, Ge J, Bu Z, Chen H. Enhanced protective efficacy of H5 subtype avian influenza DNA vaccine with codon optimized HA gene in a pCAGGS plasmid vector. Antiviral research. 2007; 75(3); 234-241. [PubMed: 17451817].
12. Kodihalli et al., 1999: Kodihalli S, Goto H, Kobasa DL, Krauss S, Kawaoka Y, Webster RG. DNA vaccine encoding hemagglutinin provides protective immunity against H5N1 influenza virus infection in mice. Journal of virology. 1999; 73(3); 2094-2098. [PubMed: 9971791].
13. Liljebjelke et al., 2010: Liljebjelke KA, Petkov DI, Kapczynski DR. Mucosal vaccination with a codon-optimized hemagglutinin gene expressed by attenuated Salmonella elicits a protective immune response in chickens against highly pathogenic avian influenza. Vaccine. 2010; 28(27); 4430-4437. [PubMed: 20406663].
14. Lunn et al., 1999: Lunn DP, Soboll G, Schram BR, Quass J, McGregor MW, Drape RJ, Macklin MD, McCabe DE, Swain WF, Olsen CW. Antibody responses to DNA vaccination of horses using the influenza virus hemagglutinin gene. Vaccine. 1999; 17(18); 2245-2258. [PubMed: 10403592].
15. Luo et al., 2008: Luo M, Tao P, Li J, Zhou S, Guo D, Pan Z. Immunization with plasmid DNA encoding influenza A virus nucleoprotein fused to a tissue plasminogen activator signal sequence elicits strong immune responses and protection against H5N1 challenge in mice. Journal of virological methods. 2008; 154(1-2); 121-127. [PubMed: 18789973].
16. Muller et al., 1990: Muller S, Plaué S, Samama JP, Valette M, Briand JP, Van Regenmortel MH. Antigenic properties and protective capacity of a cyclic peptide corresponding to site A of influenza virus haemagglutinin. Vaccine. 1990; 8(4); 308-314. [PubMed: 2396470].
17. Oh et al., 2010: Oh HL, Akerstrom S, Shen S, Bereczky S, Karlberg H, Klingström J, Lal SK, Mirazimi A, Tan YJ. An antibody against a novel and conserved epitope in the HA1 subunit neutralizes numerous H5N1 influenza viruses. Journal of virology. 2010; ; . [PubMed: 20519402].
18. Prabakaran et al., 2010: Prabakaran M, Madhan S, Prabhu N, Qiang J, Kwang J. Gastrointestinal delivery of baculovirus displaying influenza virus hemagglutinin protects mice against heterologous H5N1 infection. Journal of virology. 2010; 84(7); 3201-3209. [PubMed: 20071572].
19. Rao et al., 2010: Rao SS, Kong WP, Wei CJ, Van Hoeven N, Gorres JP, Nason M, Andersen H, Tumpey TM, Nabel GJ. Comparative efficacy of hemagglutinin, nucleoprotein, and matrix 2 protein gene-based vaccination against H5N1 influenza in mouse and ferret. PloS one. 2010; 5(3); e9812. [PubMed: 20352112].
20. Reichert and Mauler, 1975: Reichert E, Mauler R. Effect of neuraminidase on potency of inactivated influenza virus vaccines in mice. Developments in biological standardization. 1975; 28; 319-323. [PubMed: 1126575].
21. Roberts et al., 1999: Roberts A, Buonocore L, Price R, Forman J, Rose JK. Attenuated vesicular stomatitis viruses as vaccine vectors. Journal of virology. 1999; 73(5); 3723-3732. [PubMed: 10196265].
22. Rota et al., 1987: Rota PA, Shaw MW, Kendal AP. Comparison of the immune response to variant influenza type B hemagglutinins expressed in vaccinia virus. Virology. 1987; 161(2); 269-275. [PubMed: 3318092].
23. Roy et al., 2007: Roy S, Kobinger GP, Lin J, Figueredo J, Calcedo R, Kobasa D, Wilson JM. Partial protection against H5N1 influenza in mice with a single dose of a chimpanzee adenovirus vector expressing nucleoprotein. Vaccine. 2007; 25(39-40); 6845-6851. [PubMed: 17728024].
24. Song et al., 2008: Song L, Nakaar V, Kavita U, Price A, Huleatt J, Tang J, Jacobs A, Liu G, Huang Y, Desai P, Maksymiuk G, Takahashi V, Umlauf S, Reiserova L, Bell R, Li H, Zhang Y, McDonald WF, Powell TJ, Tussey L. Efficacious recombinant influenza vaccines produced by high yield bacterial expression: a solution to global pandemic and seasonal needs. PloS one. 2008; 3(5); e2257. [PubMed: 18493310].
25. Song et al., 2009: Song L, Zhang Y, Yun NE, Poussard AL, Smith JN, Smith JK, Borisevich V, Linde JJ, Zacks MA, Li H, Kavita U, Reiserova L, Liu X, Dumuren K, Balasubramanian B, Weaver B, Parent J, Umlauf S, Liu G, Huleatt J, Tussey L, Paessler S. Superior efficacy of a recombinant flagellin:H5N1 HA globular head vaccine is determined by the placement of the globular head within flagellin. Vaccine. 2009; 27(42); 5875-5884. [PubMed: 19654064].
26. Tamura et al., 1989: Tamura SI, Samegai Y, Kurata H, Kikuta K, Nagamine T, Aizawa C, Kurata T. Enhancement of protective antibody responses by cholera toxin B subunit inoculated intranasally with influenza vaccine. Vaccine. 1989; 7(3); 257-262. [PubMed: 2781859].
27. Tamura et al., 1996: Tamura S, Miyata K, Matsuo K, Asanuma H, Takahashi H, Nakajima K, Suzuki Y, Aizawa C, Kurata T. Acceleration of influenza virus clearance by Th1 cells in the nasal site of mice immunized intranasally with adjuvant-combined recombinant nucleoprotein. Journal of immunology (Baltimore, Md. : 1950). 1996; 156(10); 3892-3900. [PubMed: 8621928].
28. Tite et al., 1990: Tite JP, Hughes-Jenkins C, O'Callaghan D, Dougan G, Russell SM, Gao XM, Liew FY. Anti-viral immunity induced by recombinant nucleoprotein of influenza A virus. II. Protection from influenza infection and mechanism of protection. Immunology. 1990; 71(2); 202-207. [PubMed: 2172156].
29. Watanabe et al., 2009: Watanabe S, Watanabe T, Kawaoka Y. Influenza A virus lacking M2 protein as a live attenuated vaccine. Journal of virology. 2009; 83(11); 5947-5950. [PubMed: 19321619].