VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Bacillus anthracis

Table of Contents
  1. Protective Antigens
    1. Lef
    2. Lef from B. anthracis str. A2012
    3. LF
    4. NEAT
    5. PA
    6. PA63
    7. PA63-LAMP1
    8. PA83
    9. pagA
    10. PagA from B. anthracis str. 'Ames Ancestor'
    11. S-layer protein
    12. TPA-PA63
    13. TPA-PA63-LAMP1
    14. UQ-PA63
1. Lef
  • Gene Name : Lef
  • Sequence Strain (Species/Organism) : Bacillus anthracis str. 'Ames Ancestor'
  • VO ID : VO_0010873
  • NCBI Gene ID : 2820148
  • NCBI Protein GI : 47566484
  • Locus Tag : GBAA_pXO1_0172
  • Genbank Accession : AE017336
  • Protein Accession : YP_016503
  • 3D structure: PDB ID : 1J7N
  • Other Database IDs : CDD:285037
    CDD:286266
    CDD:238144
  • Taxonomy ID : 261594
  • Plasmid No : pXO1
  • Gene Starting Position : 149356
  • Gene Ending Position : 151785
  • Gene Strand (Orientation) : -
  • Protein Name : lethal factor
  • Protein pI : 5.69
  • Protein Weight : 89799.18
  • Protein Length : 809
  • Protein Note : Anthrax toxin lethal factor, N- and C-terminal domain; pfam07737
  • DNA Sequence : Show Sequence
    >NC_007322.2:149356-151785 Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence
    CTTATGAGTTAATAATGAACTTAATCTGATCGTTAATAAATTGGAAAGTTTTCGGAGCATTTTTTTGAAC
    TTTTAAACGTTCAGCATGGTCCGTAGAATGCATTAACCTAAAGGCTTCTGCAAAAAATTCCGCTTCATTT
    GTTCTCCCATACGAAGTTAAATTACTCCCTTCTTCCTTAAAAATATCAATGAATTTTTTAGAATTTGTAA
    CTAAATCAGATTGGTTCTTATCTAATAGATATCCAGCATAATCATCCACAGCATGTCCAAATTCGTGTAT
    AAAACCCTCACTATCATTCCTTAATTCTACACCTTTTGAAGGTCCATGGAGTAATATAGAACGGGATTCT
    GGAACATATAACCCTTTTGAATGAACTTGCTCATATATCTCATCTTGATGTGTATATTGTTCAGCTATAT
    TAGGGAGAGTAATATCGGTAAAAACAAATCTTCCATTACCATCAACTAAGTAATTTGTTACCTTTTTTAT
    AAGATCACTTTGAATATTATTTTTCCATTCATTCAATATTAAATAAGCACTTTCTACAATATTGGATGCA
    TATCTATTATGCACGTTGAATGTAATAAGCTTTGTATATTTTGGTAACCCTAATGCTTTATTCCATTCCT
    GATTTATATTTAACTGTGCTTCTTGAATTTTTGTATCTATTTTACTCTTTGGCACTACTTTCGCATCAAT
    CCTTATATATTCTTTTTCGGATTGCTTAATTATTTGTACATCCTTTATTTCCAGACCGATGTTTCTTTGT
    AATATAAGCTTTCCATTTTCTAAATATCCTGCTCGAGTATCTGGTGATAATTGGATTCTCCATTTCAAAC
    GCTCATTATCTAATGCAGGCCTTTCATTTATATCAACAATCATATAGTTACTAGAAATACTATATTTGAA
    ATTTTTTTTGAATTCATTGAAAATACCTCTATTAATTTTAGTATTATCAGTGGAATCAACTAAATCCGCA
    CCTAGGGTTGCTGTAAGGTTATTGATATTCATATTTTCATACAAATAAATTTTATTGTACAAGGTACTTC
    CAATGGATTGATGTAATAAAGCATCAATATTTTGAATATCCCTTTTATACTGCTTTCTTACATCAAGATT
    AATTGACGGACTATCAATTAACCCTCCTGTATCTTGCAACCTTTGATTAATATCATATGGTTGAATATCA
    AGTTTCAGCTTTTTTAAAAACTCTTTTTCTTTTTCAGATAAAGGATTACTACTATCCACCTGTATTCTAT
    TTAAAAGCTCTTTTTCTTCTTCAGATAAAGAATCACGAATATCAATTTGTAGCTTTTTTAAAAACTCTTT
    TTCCTCAGTAGATAAAAAATCACTACTATCAATTTGTATTCTTTTTAGAAGCTCTTTTTCTTCTTGAGAT
    AAAGAATGAATTATGTCATCTTTCTTTGGCTCAATAGGAATCTGCAGCTTTTTTAAAAGTCCTCTTCCTT
    CTTCAGATAAAGAATCGCTCCAGTGTTGATAGTGCTGTTTTATCTTTTCCCATTTTTCATATCTTGCCAG
    CATCCGTTGATCTTTAAGTTCTTCCAAGGATAGATTTATTTCTTGTTCGTTAAATTTATCCATGTAATTA
    AAAGCTTCCGGTGCATAAAGCTGTAAAACATCACGATGCTGTGGCTCGATATAATATGCAAAAGCTTTCG
    CAAATACTTCTTGTACCTCATTGCTATTTTGTTCCAAGAATTCTACAGAAAAGTCTGTGGGATGTTCCTT
    AAGCTGATTAGTAAATAAAAGATCTTGTCCATCTGAATCAGATGCATTTTTAATGGTATTTAATACATCT
    AAAAATTTCTGATATGGTTGATTAATTTTACTTAAAATATCCCTTGATAATATCTTACCTATTTCATAAT
    AAACGTTCAGTGCCTTTTCAGTATTTTCTACATAATCTTCCGAAGATTGGATTACAAGTACGGGTTCATA
    TCCTTCTTTTGCATATACATAATGTTCATGTAATAAAGCATCTTTCCCATAAATGTCTTTTATTTTTTTC
    TTATCTTCAGATAATGCTTCTAAAGATATATGTTTTGTAATATCACCATCCACAATATATATCTTTCCTC
    CAATTGCTTTATACATCTCTAAAACATCAGATGGTACTTTCTCAAGTAGCTTTTCTGCTGCCTCTTTTTT
    AACAGCTTCCTCCCCTTTTACTTCTATTTTTACAATGTGTTTCATGATTTCCTTTAAATGCTCTTCCTGT
    GTTTTATTTCGTTCTTCATCTTTTCTCTTATTCTCATCTTTATTTTTCTCTTTCTCTTTTACGTGCATAC
    CTACATCACCATGACCGCCCGCCCCCTGTACAAGGGGGATAAAGACGGGACCACTCAAAGTAATTGCTGT
    TACTAAACATGACATACTAATTACTTTTATAAATTCTTTTTTTATATTCA
    
    
  • Protein Sequence : Show Sequence
    >YP_016503.2 lethal factor (plasmid) [Bacillus anthracis str. 'Ames Ancestor']
    MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLK
    EIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDI
    YGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTI
    KNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKF
    NEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKE
    LLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
    INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDS
    TDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGL
    EIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVE
    SAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSIL
    LHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFF
    AEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. anthracis DNA vaccine LF pDNA encoding LF , pCLF4
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.237
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
2. Lef from B. anthracis str. A2012
  • Gene Name : Lef from B. anthracis str. A2012
  • Sequence Strain (Species/Organism) : Bacillus anthracis str. A2012
  • VO ID : VO_0010857
  • NCBI Gene ID : 1158731
  • NCBI Protein GI : 21392848
  • Locus Tag : BXA0172
  • Genbank Accession : AE011190
  • Protein Accession : NP_652928
  • 3D structure: PDB ID : 1J7N
  • Taxonomy ID : 191218
  • Gene Starting Position : 149356
  • Gene Ending Position : 151785
  • Gene Strand (Orientation) : -
  • Protein Name : lethal factor
  • Protein pI : 5.69
  • Protein Weight : 89799.18
  • Protein Length : 809
  • DNA Sequence : Show Sequence
    >NC_003980.1:149356-151785 Bacillus anthracis str. A2012 plasmid pXO1, complete sequence
    CTTATGAGTTAATAATGAACTTAATCTGATCGTTAATAAATTGGAAAGTTTTCGGAGCATTTTTTTGAAC
    TTTTAAACGTTCAGCATGGTCCGTAGAATGCATTAACCTAAAGGCTTCTGCAAAAAATTCCGCTTCATTT
    GTTCTCCCATACGAAGTTAAATTACTCCCTTCTTCCTTAAAAATATCAATGAATTTTTTAGAATTTGTAA
    CTAAATCAGATTGGTTCTTATCTAATAGATATCCAGCATAATCATCCACAGCATGTCCAAATTCGTGTAT
    AAAACCCTCACTATCATTCCTTAATTCTACACCTTTTGAAGGTCCATGGAGTAATATAGAACGGGATTCT
    GGAACATATAACCCTTTTGAATGAACTTGCTCATATATCTCATCTTGATGTGTATATTGTTCAGCTATAT
    TAGGGAGAGTAATATCGGTAAAAACAAATCTTCCATTACCATCAACTAAGTAATTTGTTACCTTTTTTAT
    AAGATCACTTTGAATATTATTTTTCCATTCATTCAATATTAAATAAGCACTTTCTACAATATTGGATGCA
    TATCTATTATGCACGTTGAATGTAATAAGCTTTGTATATTTTGGTAACCCTAATGCTTTATTCCATTCCT
    GATTTATATTTAACTGTGCTTCTTGAATTTTTGTATCTATTTTACTCTTTGGCACTACTTTCGCATCAAT
    CCTTATATATTCTTTTTCGGATTGCTTAATTATTTGTACATCCTTTATTTCCAGACCGATGTTTCTTTGT
    AATATAAGCTTTCCATTTTCTAAATATCCTGCTCGAGTATCTGGTGATAATTGGATTCTCCATTTCAAAC
    GCTCATTATCTAATGCAGGCCTTTCATTTATATCAACAATCATATAGTTACTAGAAATACTATATTTGAA
    ATTTTTTTTGAATTCATTGAAAATACCTCTATTAATTTTAGTATTATCAGTGGAATCAACTAAATCCGCA
    CCTAGGGTTGCTGTAAGGTTATTGATATTCATATTTTCATACAAATAAATTTTATTGTACAAGGTACTTC
    CAATGGATTGATGTAATAAAGCATCAATATTTTGAATATCCCTTTTATACTGCTTTCTTACATCAAGATT
    AATTGACGGACTATCAATTAACCCTCCTGTATCTTGCAACCTTTGATTAATATCATATGGTTGAATATCA
    AGTTTCAGCTTTTTTAAAAACTCTTTTTCTTTTTCAGATAAAGGATTACTACTATCCACCTGTATTCTAT
    TTAAAAGCTCTTTTTCTTCTTCAGATAAAGAATCACGAATATCAATTTGTAGCTTTTTTAAAAACTCTTT
    TTCCTCAGTAGATAAAAAATCACTACTATCAATTTGTATTCTTTTTAGAAGCTCTTTTTCTTCTTGAGAT
    AAAGAATGAATTATGTCATCTTTCTTTGGCTCAATAGGAATCTGCAGCTTTTTTAAAAGTCCTCTTCCTT
    CTTCAGATAAAGAATCGCTCCAGTGTTGATAGTGCTGTTTTATCTTTTCCCATTTTTCATATCTTGCCAG
    CATCCGTTGATCTTTAAGTTCTTCCAAGGATAGATTTATTTCTTGTTCGTTAAATTTATCCATGTAATTA
    AAAGCTTCCGGTGCATAAAGCTGTAAAACATCACGATGCTGTGGCTCGATATAATATGCAAAAGCTTTCG
    CAAATACTTCTTGTACCTCATTGCTATTTTGTTCCAAGAATTCTACAGAAAAGTCTGTGGGATGTTCCTT
    AAGCTGATTAGTAAATAAAAGATCTTGTCCATCTGAATCAGATGCATTTTTAATGGTATTTAATACATCT
    AAAAATTTCTGATATGGTTGATTAATTTTACTTAAAATATCCCTTGATAATATCTTACCTATTTCATAAT
    AAACGTTCAGTGCCTTTTCAGTATTTTCTACATAATCTTCCGAAGATTGGATTACAAGTACGGGTTCATA
    TCCTTCTTTTGCATATACATAATGTTCATGTAATAAAGCATCTTTCCCATAAATGTCTTTTATTTTTTTC
    TTATCTTCAGATAATGCTTCTAAAGATATATGTTTTGTAATATCACCATCCACAATATATATCTTTCCTC
    CAATTGCTTTATACATCTCTAAAACATCAGATGGTACTTTCTCAAGTAGCTTTTCTGCTGCCTCTTTTTT
    AACAGCTTCCTCCCCTTTTACTTCTATTTTTACAATGTGTTTCATGATTTCCTTTAAATGCTCTTCCTGT
    GTTTTATTTCGTTCTTCATCTTTTCTCTTATTCTCATCTTTATTTTTCTCTTTCTCTTTTACGTGCATAC
    CTACATCACCATGACCGCCCGCCCCCTGTACAAGGGGGATAAAGACGGGACCACTCAAAGTAATTGCTGT
    TACTAAACATGACATACTAATTACTTTTATAAATTCTTTTTTTATATTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_652928.1 lethal factor (plasmid) [Bacillus anthracis str. A2012]
    MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLK
    EIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDI
    YGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTI
    KNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKF
    NEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKE
    LLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
    INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDS
    TDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGL
    EIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVE
    SAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSIL
    LHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFF
    AEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): DNA vaccine encoding PA83 and LF
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.237
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
3. LF
  • Gene Name : LF
  • Sequence Strain (Species/Organism) : synthetic construct
  • NCBI Protein GI : 40646955
  • Other Database IDs : CDD:285037
    CDD:294115
    CDD:238144
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : lethal factor domains I-III
  • Protein pI : 5.34
  • Protein Weight : 64562.77
  • Protein Length : 645
  • Protein Note : Homo sapiens tissue plasminogen activator signal peptide
  • Protein Sequence : Show Sequence
    >AAR88322.1 lethal factor domains I-III [synthetic construct]
    MDAMKRGLCCVLLLCGAVFVSPSAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIE
    VKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEH
    YVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQD
    LLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLE
    ELKDQRMLSRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS
    DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGG
    LIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGI
    FNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQ
    SEKEYIRIDAKVV
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.189
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
4. NEAT
  • Gene Name : NEAT
  • Sequence Strain (Species/Organism) : Bacillus anthracis
  • NCBI Protein GI : WP_080489610
  • Other Database IDs : CDD:309946
    CDD:132993
    CDD:227223
    CDD:275380
    CDD:275378
    CDD:306825
  • Taxonomy ID : 1392
  • Gene Strand (Orientation) : ?
  • Protein Name : NEAT domain-containing leucine-rich repeat protein
  • Protein pI : 5.8
  • Protein Weight : 81601.3
  • Protein Length : 872
  • Protein Note : Iron Transport-associated domain; pfam05031
  • Protein Sequence : Show Sequence
    >WP_080489610.1 NEAT domain-containing leucine-rich repeat protein [Bacillus anthracis]
    MIGDIILKKIYMKALVVATTLAIPFAAYSTPALAAIKIEANQSVAASDRTYDTEIKIYKDQKDEPSMVSQ
    YIKDPKVAIVAGKKIVTVTMQDSDYFQYLRIEDRNQPGVFHDVKVLSEDKRKNGTKVIQFEIGEFEKKHN
    MQMHILIPAIGYDHKYQVQFEIKDPTVGDKETEKPDDNSNSGNTETDKPVDNQNMITDNKLRELVNKKVF
    NRKDVNTPITKEELLQVKNLFLNTNEILDYSALKYMPNLKSLTVANAKIKDPSFFANLKQLNHLALRGNE
    FSDVTPLVKMDHLDSLDLSNNKITNVAPLIEMKNVKSLYLSGNQIEDVTALAKMEQLDYLNLANNKITNV
    APLSALKNVTYLTLAGNQIEDIKPLYSLPLTDLVLTRNKVKDLSGIEQMKQLEELWIGKNEIKDVTPLSK
    MTQLKQLHLPNNELKDITPLSSLVNLQKLDLEANYISDLTPASNLKKLVFLSFVANEIRDVRPVIELSKT
    AYINVQNQKVFLEETEVNKEVKVPIYEKDGKISTKIRLKDEGGTYSNDAVKWSTPGEKVYEFGVKDPFAD
    TGIFFTGSVIQNVVESKADNISKEDNTSKEDAKVEVVEFKDVPKGHWSEEAIHYLAKENIFKGYGNGQFG
    FGDSITRGQVASLVQRYLKLENKVEQKERFTDTKGHMFEQDIATVAQAGIMQGDGTGEFRPDGVLTRYEM
    SVVLYKVFQLKEDGNNKVNFKDVPTGHWAEGYVKALVDNNISKGDGKERFLGDDFVTREQYAQFLYNAIT
    K
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Balderas et al., 2016)
  • Localization(Probability): Cellwall
    (Prob.=1)
  • Adhesin Probability: 0.360
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
5. PA
  • Gene Name : PA
  • Sequence Strain (Species/Organism) : Bacillus anthracis str. H9401
  • NCBI Gene ID : 12796252
  • NCBI Protein GI : 386733821
  • Locus Tag : H9401_5741
  • Genbank Accession : CP002093
  • Protein Accession : YP_006204206
  • Taxonomy ID : 768494
  • Plasmid No : BAP2
  • Gene Starting Position : 46551
  • Gene Ending Position : 46985
  • Gene Strand (Orientation) : -
  • Protein Name : Phosphoesterase PA-phosphatase related protein
  • Protein pI : 9.43
  • Protein Weight : 14561.26
  • Protein Length : 144
  • DNA Sequence : Show Sequence
    >NC_017727.1:46551-46985 Bacillus anthracis str. H9401 plasmid BAP2, complete sequence
    ATTATAATTCCTTCGATTTACTTTTTAATGGTAAAACATATTGCTCTACTCTTTCATAAAGATTAAGTAT
    TTGTGTAATAAATTTAATTTTTGGTACTATCCAATATGAAAATAAAGCTGAAATACTCCCTATTAAGGCG
    CCTGTTGCAACATCAAAAGGATAATGAACCCCGACCCAAATACGAGAGATACCCACACAGAATGCAATTA
    CAAGCAATAACAACCCAGCCTTTTTATGAACGAGCTTAACTGAAACACAAATTGAAAAAAATAGAATCGT
    GTGATCACTAGGAAATGAATTATCCACTACATGATCAGCGAGTTTATTAACATCAGGTAATACTGCAAAT
    GGTTGATAATTCAAATGCAATTTCCCTAGTAGCTTTCCAATTATCTCAGCAGTCATGAAAGCAAACACCG
    CTTGTATAATCATCA
    
    
  • Protein Sequence : Show Sequence
    >YP_006204206.1 Phosphoesterase PA-phosphatase related protein (plasmid) [Bacillus anthracis str. H9401]
    MMIIQAVFAFMTAEIIGKLLGKLHLNYQPFAVLPDVNKLADHVVDNSFPSDHTILFFSICVSVKLVHKKA
    GLLLLVIAFCVGISRIWVGVHYPFDVATGALIGSISALFSYWIVPKIKFITQILNLYERVEQYVLPLKSK
    SKEL
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. anthracis DNA Vaccine expressing PA , Typhi strain Ty21a-PA (Bacillus anthracis)
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=0.999)
  • Adhesin Probability: 0.197
  • Trans-membrane helices: 2
  • Detailed Vaxign Results Vaxign Results
6. PA63
  • Gene Name : PA63
  • Sequence Strain (Species/Organism) : synthetic construct derived from Bacillus anthracis
  • NCBI Protein GI : 193873769
  • Other Database IDs : CDD:281492
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : PA63
  • Protein pI : 5.74
  • Protein Weight : 60404.36
  • Protein Length : 613
  • Protein Note : derived from Bacillus anthracis
  • Protein Sequence : Show Sequence
    >ACF23542.1 PA63 [synthetic construct]
    MPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTG
    RIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHA
    SFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTT
    SLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD
    TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARISFNGKDLNLVERRIAAVNPSDPLETTKPGM
    TLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILI
    RDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYD
    MLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKG
    YEIG
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.474
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
7. PA63-LAMP1
  • Gene Name : PA63-LAMP1
  • Sequence Strain (Species/Organism) : synthetic construct derived from Bacillus anthracis
  • NCBI Protein GI : 193873761
  • Other Database IDs : CDD:281492
    CDD:213052
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : PA63-LAMP1
  • Protein pI : 6.22
  • Protein Weight : 64720.28
  • Protein Length : 659
  • Protein Note : Clostridial binary toxin B/anthrax toxin PA; pfam03495
  • Protein Sequence : Show Sequence
    >ACF23538.1 PA63-LAMP1 [synthetic construct]
    MPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTG
    RIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHA
    SFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTT
    SLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD
    TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDM
    TLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILI
    RDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKISSGYIVEIEDTEGLKEVINDRYD
    MLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKG
    YEIGGLNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. anthracis DNA vaccine pLAMP1-PA63
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.455
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
8. PA83
  • Gene Name : PA83
  • Sequence Strain (Species/Organism) : synthetic construct
  • NCBI Protein GI : 40646953
  • Protein Accession : AAR88321.1
  • Other Database IDs : CDD:284994
    CDD:281492
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : protective antigen PA83
  • Protein pI : 5.32
  • Protein Weight : 80526.18
  • Protein Length : 822
  • Protein Note : Homo sapiens tissue plasminogen activator signal peptide
  • Protein Sequence : Show Sequence
    >AAR88321.1 protective antigen PA83 [synthetic construct]
    MDAMKRGLCCVLLLCGAVFVSPSEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPS
    SELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIK
    IQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNTSAGPTVPDRDNDGIPDSLEVEGYT
    VDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVH
    VDMENIILSKNEDQSTQNTDSETRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVA
    IDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQ
    ILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDT
    GSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQ
    GKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVK
    EAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYND
    KLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. anthracis DNA vaccine PA83 furin , B. anthracis DNA vaccine pDNA encoding PA
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.438
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
9. pagA
  • Gene Name : pagA
  • Sequence Strain (Species/Organism) : Bacillus anthracis
  • VO ID : VO_0011029
  • NCBI Protein GI : 9280533
  • 3D structure: PDB ID : 1ACC
  • Other Database IDs : ATCC:14185
    CDD:311565
    CDD:281492
  • Taxonomy ID : 1392
  • Gene Strand (Orientation) : ?
  • Protein Name : protective antigen
  • Protein pI : 6.09
  • Protein Weight : 81760.71
  • Protein Length : 838
  • Protein Note : PA14 domain; pfam07691
  • Protein Sequence : Show Sequence
    >AAF86457.1 protective antigen (plasmid) [Bacillus anthracis]
    MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTG
    DLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKG
    RLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDND
    GIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEA
    RHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVS
    AGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL
    ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIAT
    YNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAF
    GFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNVTNIYTVLDKIKLNAKMNILIRDKRFHYDRN
    NIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQD
    GKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Study described the construction and evaluation of an adenovirus vaccine expressing domain 4 of Bacillus anthracis protective antigen, Ad.D4. Ad.D4 elicited antibodies to protective antigen 14 days after a single intramuscular injection, which were further increased upon boosting. Furthermore, two doses of Ad.D4 4 weeks apart were sufficient to protect 67% of mice from toxin challenge (McConnell et al., 2006).
  • Related Vaccine(s): B. anthracis DNA Vaccine expressing PA , B. anthracis DNA vaccine PA , B. anthracis DNA vaccine pCPA , B. anthracis DNA vaccine pIMS-120 encoding PA , B. anthracis DNA vaccine pSecTag PA83 encoding PA , pCMV/ER-PA83 , rLAG- PA-DCpep
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.389
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
10. PagA from B. anthracis str. 'Ames Ancestor'
  • Gene Name : PagA from B. anthracis str. 'Ames Ancestor'
  • Sequence Strain (Species/Organism) : Bacillus anthracis str. 'Ames Ancestor'
  • VO ID : VO_0010872
  • NCBI Gene ID : 2820165
  • NCBI Protein GI : 47566476
  • Locus Tag : GBAA_pXO1_0164
  • Genbank Accession : AE017336
  • Protein Accession : YP_016495
  • 3D structure: PDB ID : 1ACC
  • Taxonomy ID : 261594
  • Plasmid No : pXO1
  • Gene Starting Position : 143778
  • Gene Ending Position : 146072
  • Gene Strand (Orientation) : +
  • Protein Name : protective antigen
  • Protein pI : 6.09
  • Protein Weight : 81542.47
  • Protein Length : 764
  • Protein Note : similar to SP:P13423; identified by sequence similarity; putative
  • Protein Annotation : Protective antigen (PA) is the dominant antigen in both natural and vaccine-induced immunity to anthrax infection and consists of four distinct and functionally independent domains. Domain 1 is divided into domains 1a (consisting of amino acids 1-167) and 1b (consisting of aa 168-258). Domain 2 comprises aa 259-487 and domain 3 aa 488-595. After the antigen binds to the host cell receptor via the binding site of domain 4, the N-terminal amino acids (1-167, i.e. domain 1a) of domain 1, which contain a furin protease cleavage site, are cleaved off, exposing the LF or EF binding site located in domain 1b and the adjacent domain 3. Domains 2 and 3 then form part of a heptameric pore on the cell surface, the LF or EF binds to its receptor, and the whole toxin complex undergoes receptor-mediated endocytosis into the cell. After acidification of the endosome, the toxin is translocated into the cell cytosol where it exerts its cytotoxic effect. Therefore, inhibition of the binding and entry of the toxin complex, particularly lethal toxin, into the host cell is clearly important for the prevention of infection (Flick-Smith et al., 2002).
  • DNA Sequence : Show Sequence
    >NC_007322.2:143778-146072 Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence
    TATGAAAAAACGAAAAGTGTTAATACCATTAATGGCATTGTCTACGATATTAGTTTCAAGCACAGGTAAT
    TTAGAGGTGATTCAGGCAGAAGTTAAACAGGAGAACCGGTTATTAAATGAATCAGAATCAAGTTCCCAGG
    GGTTACTAGGATACTATTTTAGTGATTTGAATTTTCAAGCACCCATGGTGGTTACCTCTTCTACTACAGG
    GGATTTATCTATTCCTAGTTCTGAGTTAGAAAATATTCCATCGGAAAACCAATATTTTCAATCTGCTATT
    TGGTCAGGATTTATCAAAGTTAAGAAGAGTGATGAATATACATTTGCTACTTCCGCTGATAATCATGTAA
    CAATGTGGGTAGATGACCAAGAAGTGATTAATAAAGCTTCTAATTCTAACAAAATCAGATTAGAAAAAGG
    AAGATTATATCAAATAAAAATTCAATATCAACGAGAAAATCCTACTGAAAAAGGATTGGATTTCAAGTTG
    TACTGGACCGATTCTCAAAATAAAAAAGAAGTGATTTCTAGTGATAACTTACAATTGCCAGAATTAAAAC
    AAAAATCTTCGAACTCAAGAAAAAAGCGAAGTACAAGTGCTGGACCTACGGTTCCAGACCGTGACAATGA
    TGGAATCCCTGATTCATTAGAGGTAGAAGGATATACGGTTGATGTCAAAAATAAAAGAACTTTTCTTTCA
    CCATGGATTTCTAATATTCATGAAAAGAAAGGATTAACCAAATATAAATCATCTCCTGAAAAATGGAGCA
    CGGCTTCTGATCCGTACAGTGATTTCGAAAAGGTTACAGGACGGATTGATAAGAATGTATCACCAGAGGC
    AAGACACCCCCTTGTGGCAGCTTATCCGATTGTACATGTAGATATGGAGAATATTATTCTCTCAAAAAAT
    GAGGATCAATCCACACAGAATACTGATAGTCAAACGAGAACAATAAGTAAAAATACTTCTACAAGTAGGA
    CACATACTAGTGAAGTACATGGAAATGCAGAAGTGCATGCGTCGTTCTTTGATATTGGTGGGAGTGTATC
    TGCAGGATTTAGTAATTCGAATTCAAGTACGGTCGCAATTGATCATTCACTATCTCTAGCAGGGGAAAGA
    ACTTGGGCTGAAACAATGGGTTTAAATACCGCTGATACAGCAAGATTAAATGCCAATATTAGATATGTAA
    ATACTGGGACGGCTCCAATCTACAACGTGTTACCAACGACTTCGTTAGTGTTAGGAAAAAATCAAACACT
    CGCGACAATTAAAGCTAAGGAAAACCAATTAAGTCAAATACTTGCACCTAATAATTATTATCCTTCTAAA
    AACTTGGCGCCAATCGCATTAAATGCACAAGACGATTTCAGTTCTACTCCAATTACAATGAATTACAATC
    AATTTCTTGAGTTAGAAAAAACGAAACAATTAAGATTAGATACGGATCAAGTATATGGGAATATAGCAAC
    ATACAATTTTGAAAATGGAAGAGTGAGGGTGGATACAGGCTCGAACTGGAGTGAAGTGTTACCGCAAATT
    CAAGAAACAACTGCACGTATCATTTTTAATGGAAAAGATTTAAATCTGGTAGAAAGGCGGATAGCGGCGG
    TTAATCCTAGTGATCCATTAGAAACGACTAAACCGGATATGACATTAAAAGAAGCCCTTAAAATAGCATT
    TGGATTTAACGAACCGAATGGAAACTTACAATATCAAGGGAAAGACATAACCGAATTTGATTTTAATTTC
    GATCAACAAACATCTCAAAATATCAAGAATCAGTTAGCGGAATTAAACGCAACTAACATATATACTGTAT
    TAGATAAAATCAAATTAAATGCAAAAATGAATATTTTAATAAGAGATAAACGTTTTCATTATGATAGAAA
    TAACATAGCAGTTGGGGCGGATGAGTCAGTAGTTAAGGAGGCTCATAGAGAAGTAATTAATTCGTCAACA
    GAGGGATTATTGTTAAATATTGATAAGGATATAAGAAAAATATTATCAGGTTATATTGTAGAAATTGAAG
    ATACTGAAGGGCTTAAAGAAGTTATAAATGACAGATATGATATGTTGAATATTTCTAGTTTACGGCAAGA
    TGGAAAAACATTTATAGATTTTAAAAAATATAATGATAAATTACCGTTATATATAAGTAATCCCAATTAT
    AAGGTAAATGTATATGCTGTTACTAAAGAAAACACTATTATTAATCCTAGTGAGAATGGGGATACTAGTA
    CCAACGGGATCAAGAAAATTTTAATCTTTTCTAAAAAAGGCTATGAGATAGGATA
    
    
  • Protein Sequence : Show Sequence
    >YP_016495.2 protective antigen (plasmid) [Bacillus anthracis str. 'Ames Ancestor']
    MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTG
    DLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKG
    RLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDND
    GIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEA
    RHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVS
    AGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL
    ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIAT
    YNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAF
    GFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRN
    NIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQD
    GKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Anthrax Spore Vaccine , DAAV using PA and PGA , DNA vaccine encoding PA (PA63) , DNA vaccine encoding PA83 and LF , pCLF4 , Recombinant PA domain 4
  • Localization(Probability): Extracellular
    (Prob.=1)
  • Adhesin Probability: 0.401
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
11. S-layer protein
  • Gene Name : S-layer protein
  • Sequence Strain (Species/Organism) : Bacillus anthracis
  • NCBI Protein GI : WP_047401514
  • Other Database IDs : CDD:278807
    CDD:224259
    CDD:302596
    CDD:302792
  • Taxonomy ID : 1392
  • Protein Name : S-layer protein
  • Protein pI : 9.61
  • Protein Weight : 73443.67
  • Protein Length : 711
  • Protein Note : S-layer homology domain; pfam00395
  • Protein Sequence : Show Sequence
    >WP_047401514.1 S-layer protein [Bacillus anthracis]
    MKAITSFTLIGSILFGGNINSTQAESDLKKIVPDQMVPAFLDVPSNHWANVAINNLLKKEIIVGYGNNKF
    GLGDSVTREQVAAVIYRIKFPEKEVEAEAQNPYRDVNKSSTMFLDEILTLTKMGIFSGDEKGNFRPKSPI
    SRAEMTQVIKNAFNIPVVGKHNFRDVAKDYWANDAISALQSNQLVSGTGNGLFEPYKSVTREEYAQFIFN
    VLNFEDLVNKEKQLDELNKRRDVINQKIDEFDKLNSQRKDLERMLEELNQKLSQLKQQSPQLQDLKNKLK
    ESQSRLLELNKKDSNRLELNSEIKKLNDRKAELLSLIMELIKQQSEFDKKIKNEKDDLNKKREDLINRIA
    ESKELAKKKAELNTKLVELFKVQEALNKKSGQYLYYINKLDNELRELADKYKNSDNKISRLKNHIGEYNK
    QLEKIENELEECNKKIDNTKKQLAEFDKSNKKQQELESELVQLNKKIDELGKRHKHRQELEASQKKALDE
    AKEINKKLAEKDPERQHINDKLKKLNNDWRLTNNELNRLNSELQKVNTKLLGYSQEHQYYNALNKERTEL
    SKKVDEIYQKQSEIDKNYIELNRQLDELSNPKPNEQVQLLKNQINELNSSINQILNHRKNEINNITQRKD
    HIIDQLNQFPKLRIPNS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Mikshis et al., 2014)
  • Localization(Probability): Cellwall
    (Prob.=1)
  • Adhesin Probability: 0.444
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
12. TPA-PA63
  • Gene Name : TPA-PA63
  • Sequence Strain (Species/Organism) : synthetic construct derived from Bacillus anthracis
  • NCBI Protein GI : 193873765
  • Other Database IDs : CDD:281492
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : TPA-PA63
  • Protein pI : 5.74
  • Protein Weight : 62856.12
  • Protein Length : 640
  • Protein Note : Clostridial binary toxin B/anthrax toxin PA; pfam03495
  • Protein Sequence : Show Sequence
    >ACF23540.1 TPA-PA63 [synthetic construct]
    MDAMKRGLCCVLLLCGAVFVSPSMPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTK
    YKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRT
    ISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTA
    RLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFS
    STPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDL
    NLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAE
    LNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKI
    LSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTII
    NPSENGDTSTNGIKKILIFSKKGYEIG
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. anthracis DNA vaccine pTPA-PA63
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.478
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
13. TPA-PA63-LAMP1
  • Gene Name : TPA-PA63-LAMP1
  • Sequence Strain (Species/Organism) : synthetic construct derived from Bacillus anthracis
  • NCBI Protein GI : 193873763
  • Other Database IDs : CDD:281492
    CDD:213052
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : TPA-PA63-LAMP1
  • Protein pI : 6.22
  • Protein Weight : 67115.01
  • Protein Length : 686
  • Protein Note : Clostridial binary toxin B/anthrax toxin PA; pfam03495
  • Protein Sequence : Show Sequence
    >ACF23539.1 TPA-PA63-LAMP1 [synthetic construct]
    MDAMKRGLCCVLLLCGAVFVSPSMPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTK
    YKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRT
    ISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTA
    RLDANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFS
    STPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDL
    NLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAE
    LNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKI
    LSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTII
    NPSENGDTSTNGIKKILIFSKKGYEIGGLNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. anthracis DNA vaccine pTPA-P
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.471
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
14. UQ-PA63
  • Gene Name : UQ-PA63
  • Sequence Strain (Species/Organism) : synthetic construct derived from Bacillus anthracis
  • NCBI Protein GI : 193873767
  • Other Database IDs : CDD:176398
    CDD:214563
    CDD:281492
  • Taxonomy ID : 32630
  • Gene Strand (Orientation) : ?
  • Protein Name : UQ-PA63
  • Protein pI : 5.91
  • Protein Weight : 68767.41
  • Protein Length : 694
  • Protein Note : Ubiquitin; cd01803
  • Protein Sequence : Show Sequence
    >ACF23541.1 UQ-PA63 [synthetic construct]
    MQIFVKTLTGKTTTLGVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
    LRLRGAAMPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYS
    DFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVH
    GNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPI
    YNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEK
    TKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPL
    ETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLN
    AKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKE
    VINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKI
    LIFSKKGYEIG
    
    
  • Molecule Role : Protective antigen
  • Localization(Probability): Extracellular
    (Prob.=0.998)
  • Adhesin Probability: 0.449
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
II. References
1. Balderas et al., 2016: Balderas MA, Nguyen CT, Terwilliger A, Keitel WA, Iniguez A, Torres R, Palacios F, Goulding CW, Maresso AW. Progress toward the Development of a NEAT Protein Vaccine for Anthrax Disease. Infection and immunity. 2016; 84(12); 3408-3422. [PubMed: 27647868].
2. Flick-Smith et al., 2002: Flick-Smith HC, Walker NJ, Gibson P, Bullifent H, Hayward S, Miller J, Titball RW, Williamson ED. A recombinant carboxy-terminal domain of the protective antigen of Bacillus anthracis protects mice against anthrax infection. Infection and immunity. 2002 Mar; 70(3); 1653-6. [PubMed: 11854261].
3. McConnell et al., 2006: McConnell MJ, Hanna PC, Imperiale MJ. Cytokine response and survival of mice immunized with an adenovirus expressing Bacillus anthracis protective antigen domain 4. Infection and immunity. 2006; 74(2); 1009-1015. [PubMed: 16428747].
4. Mikshis et al., 2014: Mikshis NI, Popova PIu, Kudriavtseva OM, Semakova AP, Novikova LN, Kravtsov AL, Bugorkova SA, Shchukovskaia TN, Popov IuA, Kutyrev VV. [Immunogenicity and safety of a prototype chemical anthrax vaccine in laboratory animal models]. Zhurnal mikrobiologii, epidemiologii, i immunobiologii. 2014; (4); 22-30. [PubMed: 25286524].