VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Brucella spp.

Table of Contents
  1. Protective Antigens
    1. AsnC
    2. B. abortus strain 19 L7/L12
    3. B. melitensis M5 P39
    4. BAB1_0278
    5. BCSP31
    6. Bfr from B. abortus S19
    7. Bfr from B. melitensis biovar Abortus 2308
    8. Bp26
    9. cobB
    10. DnaK
    11. Gap
    12. IalB
    13. L7/L12
    14. Omp16
    15. omp16
    16. Omp19
    17. Omp25
    18. Omp31
    19. omp31
    20. ORF
    21. P39 from Brucella abortus
    22. PALFn
    23. RplL
    24. SodC from B. abortus strain 2308
    25. SurA
    26. Tig
1. AsnC
  • Gene Name : AsnC
  • Sequence Strain (Species/Organism) : Brucella abortus 2308
  • NCBI Gene ID : 3788213
  • NCBI Protein GI : 489054600
  • Locus Tag : BAB_RS24000
  • Genbank Accession : JMRZ01000003
  • Protein Accession : WP_002964767
  • Taxonomy ID : 359391
  • Chromosome No : I
  • Gene Starting Position : 1633929
  • Gene Ending Position : 1634399
  • Gene Strand (Orientation) : -
  • Protein Name : ArsR family transcriptional regulator
  • Protein pI : 5.32
  • Protein Weight : 15857.78
  • Protein Length : 156
  • DNA Sequence : Show Sequence
    >NC_007618.1:1633929-1634399 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
    TCTAACGCCCATCCAGCGGGACGGCTGTGGTGTCCTTGATCTCTTCCATCACGAAAGAGGCCGATACATC
    CGATAGCGGTACACAGGCTATGAGGCGCTGGTAGAGCCGGTCATAAGCTCTGACATCGGAAATGCGTGCC
    TTCAGCACATAGTCCAGATCGCCGGTCATGCGATAGGCGCCGACGATTTCCGGGAAGCGAGCCACGGCAG
    CGCGGAATTTGTTCAGCCATTCGGGATCATGGGCGGAGGTGCGCACCAGAATGAAAACCGAGAGGCCATA
    GCCGACCATTTCCGCATCCACCAGCGCCACGCGACCTTTGATGACGCCATCGTCTTCCATGCGCTTTACG
    CGCCGCCAGCAGGCATTGCGCGAAAGATTCACCCGTTCGGAAAGGGAATCAACCGACAAAGTGCCGTCGT
    TTTGCAACTCAGCCAGGATTTTTCGGTCTATATCGTCCATAGATGCTGTCA
    
    
  • Protein Sequence : Show Sequence
    >WP_002964767.1 MULTISPECIES: Lrp/AsnC family transcriptional regulator [Brucella]
    MTASMDDIDRKILAELQNDGTLSVDSLSERVNLSRNACWRRVKRMEDDGVIKGRVALVDAEMVGYGLSVF
    ILVRTSAHDPEWLNKFRAAVARFPEIVGAYRMTGDLDYVLKARISDVRAYDRLYQRLIACVPLSDVSASF
    VMEEIKDTTAVPLDGR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice given BAB1_1688 (AsnC) plus adjuvant could provide protection against virulent B. abortus infection, similarly with the known protective antigen Cu-Zn SOD and the license vaccine S19 (Fu et al., 2012).
  • Related Vaccine(s): Recombinant B. abortus AsnC protein with CFA/IFA adjuvant
  • Localization(Probability): Cytoplasmic
    (Prob.=0.926)
  • Adhesin Probability: 0.147
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
2. B. abortus strain 19 L7/L12
  • Gene Name : B. abortus strain 19 L7/L12
  • Sequence Strain (Species/Organism) : Strain 19
  • VO ID : VO_0010928
  • NCBI Protein GI : 304271
  • Genbank Accession : L19101
  • Other Database IDs : CDD:234671
    CDD:100102
  • Taxonomy ID : 235
  • Gene Strand (Orientation) : ?
  • Protein Name : ribosomal protein L7/L12
  • Protein pI : 4.49
  • Protein Weight : 11795.56
  • Protein Length : 183
  • Protein Note : biovar Abortus
  • DNA Sequence : Show Sequence
    >gi|304270|gb|L19101.1|BRURPL712X Brucella abortus ribosomal protein L7/L12 gene, complete cds 
    CAAGCTCGTTATTCTCGGTGGCGCAATGGGTGCAACGACGCTTAGACCGATGGCGTCAAGTCGCTTCGTT
    CGCTCCCGTCGCTCGACGAACTGCGCGCAAAGCTGGTTGGTATGATCCAGACCCCGGCTCAGCGTCTTGC
    AGTGCTTACCAGCGCTCCGCGGGCCAGATCGCCCGCGTTATTGCGCGCACGCCCGGAAGAACGAGGCGGC
    TTAAGGCCGTTTCTCGCTGTCAACAGTTCAAACCTTAATTATAGGAAATACAAAAATGGCTGATCTCGCA
    AAGATCGTTGAAGACCTTTCGGCCCTGACCGTTCTGGAAGCCGCTGAGCTGTCCAAGCTTCTCGAAGAGA
    AGTGGGGCGTTTCGGCTGCTGCTCCGGTCGCTGTTGCTGCTGCCGGTGGCGCTGCCCCTGCTGCTGCCGC
    AGAAGAAAAGACCGAATTCGACGTCGTTCTCGCTGACGGCGGCGCTAACAAGATCAACGTGATCAAGGAA
    GTGCGCGCACTCACCGGTCTCGGCCTCAAGGAAGCCAAGGACCTGGTCGAAGGCGCTCCGAAGGCTGTCA
    AGGAAGGCGCCTCGAAGGACGAAGCTGAGAAGATCAAGGCACAGCTCGAAGCTGCTGGCGCCAAGGTTGA
    ACTCAAGTAAGTTTGGACTATT
  • Protein Sequence : Show Sequence
    >AAA19863.1 ribosomal protein L7/L12 [Brucella abortus]
    MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDVVLADGGANKI
    NVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAGAKVELK
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. abortus DNA vaccine expressing BCSP31, SOD and L7/L12 , B. abortus DNA vaccine pcDNA3.1-p39-L7/L12 encoding p39-L7/L12 fusion protein , B. abortus subunit vaccine using L7/L12
  • Localization(Probability): Unknown
    (Prob.=0.649)
  • Adhesin Probability: 0.329
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
3. B. melitensis M5 P39
  • Gene Name : B. melitensis M5 P39
  • Sequence Strain (Species/Organism) : B. melitensis strain M5
  • VO ID : VO_0010948
  • NCBI Protein GI : 122892474
  • Genbank Accession : EF189139
  • Protein Accession : ABM67295
  • Other Database IDs : CDD:224567
    CDD:304360
  • Taxonomy ID : 1004957
  • Gene Strand (Orientation) : ?
  • Protein Name : immunogenic 39-kDa protein
  • Protein pI : 4.69
  • Protein Weight : 40682.69
  • Protein Length : 483
  • Protein Note : biovar: 1 str. M5
  • DNA Sequence : Show Sequence
    >gi|122892473|gb|EF189139.1| Brucella melitensis strain M5 immunogenic 39-kDa protein gene, complete cds
    ATGGGTACGGCTTCCTGTGGTTTGCTCGCCGGAATGGCGCCTGTTGCCAATGCGCAGGAAAAGCAGAATG
    TCGAGGTTCTGCACTGGTGGACGTCCGGCGGCGAAGCGTCCGCGCTTGAAGTTTTGAAAAAAGATCTTGA
    AAGCAAGGGCATTAGCTGGACCGATATGCCGGTTGCAGGTGGCGGCGGCACGGAAGCCATGACCGTTTTG
    CGCGCGCGCGTTACCGCAGGCAATGCGCCAACCGCGGTGCAGATGCTGGGTTTTGACATTCGCGACTGGG
    CGGAGCAGGGCGCACTCGGCAATCTCGATACGGTTGCTTCCAAGGAAGGCTGGGAAAAGGTTATTCCGGC
    TCCCTTGCAGGAATTTGCCAAATATGACGGCCACTGGATTGCTGCGCCCGTCAATATTCACTCCACCAAC
    TGGATGTGGATCAACAAGGCTGCTCTCGACAAGGCTGGCGGCAAGGAGCCGACCAATTGGGATGAGCTGA
    TTGCGCTTCTCGACAATTTCAAGGCGCAGGGCATTACGCCGATCGCGCATGGCGGCCAGCCGTGGCAGGA
    TGCAACCATTTTCGATGCGGTTGTTCTTTCATTCGGCCCGGATTTCTACAAGAAGGCCTTCATCGATCTC
    GACCCGGAAGCACTGGGCAGCGATACCATGAAGCAGGCCTTCGACCGCATGTCCAAGCTTCGCACCTATG
    TTGATGACAACTTCTCCGGCCGTGACTGGAACCTTGCTTCGGCCATGGTTATCGAAGGCAAGGCCGGTGT
    CCAGTTCATGGGCGACTGGGCGAAGGGCGAGTTCCTCAAGGCGGGCAAGAAGCCGGGTGAGGATTTCGTC
    TGCATGCGTTATCCGGGCACGCAGGGTGCTGTCACTTTCAATTCCGGCATGTTCGCCATGTTCAAGGTTT
    CGGAAGACAAGGTTCCCGCACAGCTTGAAATGGCTTCGGCGATTGAAAGCCCTGCCTTCCAGTCTGCCTT
    TAATGTGGAGAAGGGGTCGGCCCCGGCACGCACGGATGTGCCCGATACCGCTTTCGATGCCTGTGGCAAG
    AAGACCATTGCCGATGTCAAGGAAGCAAACAGCAAGGGCACTCTGCTTGGCTCCATGGCGCATGGCTATG
    CCAATCCGGCTGCCGTGAAGAATGCGATCTACGACGTCGTGACCCGCCAGTTCAACGGCCAGCTTTCTTC
    GGAAGATGCCGTCAAGGAACTCGTTGTGGCGGTTGAAGCCGCAAAATAAGGCCACGCGGAAACGTCCGGG
    GGAACCTCCCGGACGTTTTTCCTGCGTGCTCCAGCAGAAGCGCATAGGCGGTTGGCGCAGCTAACCGGCA
    CTTACGACGGAATTGCATGCCGATATGCCCGCCTCACCATCCGAGGCGCGTTTCGTGGGACATAGAGC
  • Protein Sequence : Show Sequence
    >ABM67295.1 immunogenic 39-kDa protein [Brucella melitensis bv. 1 str. M5]
    MAPVANAQEKQNVEVLHWWTSGGEASALEVLKKDLESKGISWTDMPVAGGGGTEAMTVLRARVTAGNAPT
    AVQMLGFDIRDWAEQGALGNLDTVASKEGWEKVIPAPLQEFAKYDGHWIAAPVNIHSTNWMWINKAALDK
    AGGKEPTNWDELIALLDNFKAQGITPIAHGGQPWQDATIFDAVVLSFGPDFYKKAFIDLDPEALGSDTMK
    QAFDRMSKLRTYVDDNFSGRDWNLASAMVIEGKAGVQFMGDWAKGEFLKAGKKPGEDFVCMRYPGTQGAV
    TFNSGMFAMFKVSEDKVPAQLEMASAIESPAFQSAFNVEKGSAPARTDVPDTAFDACGKKTIADVKEANS
    KGTLLGSMAHGYANPAAVKNAIYDVVTRQFNGQLSSEDAVKELVVAVEAAK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The 39-kDa protein is immunogenic.
  • Related Vaccine(s): B. melitensis P39 protein vaccine
  • Localization(Probability): Periplasmic
    (Prob.=0.944)
  • Adhesin Probability: 0.506
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
4. BAB1_0278
  • Gene Name : BAB1_0278
  • Sequence Strain (Species/Organism) : Brucella melitensis biovar Abortus 2308
  • NCBI Protein GI : 82615279
  • Other Database IDs : CDD:264424
    EnsemblGenomes-Gn:BAB1_0278
    EnsemblGenomes-Tr:CAJ10234
    InterPro: IPR011681
    UniProtKB/TrEMBL: Q2YPC5
  • Taxonomy ID : 359391
  • Gene Strand (Orientation) : ?
  • Protein Name : conserved hypothetical protein
  • Protein pI : 8.51
  • Protein Weight : 8787.28
  • Protein Length : 148
  • Protein Note : GcrA cell cycle regulator; cl11564
  • Protein Sequence : Show Sequence
    >CAJ10234.1 conserved hypothetical protein [Brucella abortus 2308]
    MHWKSRSPLSEALPMFDKLTSPHEGFRLADLSRRQCKWPVNRAQAGELHLFCGEAVQNGHPYCEEHCGKA
    YTGKAGSR
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. abortus DNA vaccine pVF278
  • Localization(Probability): Unknown
    (Prob.=0.2)
  • Adhesin Probability: 0.319
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
5. BCSP31
  • Gene Name : BCSP31
  • Sequence Strain (Species/Organism) : Brucella abortus
  • NCBI Nucleotide GI : 144104
  • NCBI Protein GI : 144105
  • Protein Accession : AAA22993.1
  • Other Database IDs : CDD:273982
  • Taxonomy ID : 235
  • Gene Strand (Orientation) : ?
  • Protein Name : cell surface protein
  • Protein pI : 7.77
  • Protein Weight : 32204.04
  • Protein Length : 397
  • Protein Note : biovar Abortus
  • DNA Sequence : Show Sequence
    >gi|144104|gb|M20404.1|BRUBCSP B.abortus BCSP31 gene encoding a 31-KDa cell surface protein, complete cds
    GCGCCTATACGCGCGACCTGATCCAGTCTTTTGCATCGCGGTGCCATGTGCGTCTGGTGGGGGCCGACGG
    GCTGGCGGCGATTGCCGAAGCGCATATTCGCGGTGAAAGTTTCGATGAGGCGCTGGTCATGGCGCAGATC
    GCGCCATGTTTTATCGAAAAGGATGGCAAGCGCACCGATATCGTGGTGCTTGCCTGTACGCATTATCCGT
    TTCTCGTCAATGTATTGCGCCGTCTGGCTCCATGGCCGGTGGATTGGCTGGACCCGGCGGAAGCCATTGC
    ACGACGCATGAAATCGCTTTTGCCTGCGCGAAGTGACGATGATGAATTTCATTCTCAAGATGACCTAGCA
    TTCTTCACATCCAGGAAACCCGACTATGCCATTCGCCGCCTGATGCAGGGTTTTGGGCTGCGTTTTTAAT
    CGTTTCAGTCGGCTCTGGCGGCGCTTGTCGGCAAGCGATTGTATTCTTTGGGAAAATCCAGAATAATGGA
    ATGCGGTGGTTGACAATCGGCCTCAAGCTTCCTATGGTTTTCGGCATAATCTATGCGGGAAGAGGACTGG
    TATTATGAAATTCGGAAGCAAAATCCGTCGCTTGGCTGTTGCGGCGGTGGCGGGCGCGATTGCGTTGGGA
    GCGAGCTTTGCGGTTGCACAGGCCCCGACATTTTTCCGTATCGGCACTGGCGGCACAGCCGGAACCTATT
    ATCCGATTGGTGGTCTGATCGCGAACGCGATTTCCGGCGCAGGCGAAAAGGGCGTGCCGGGTCTCGTCGC
    GACGGCCGTTTCGTCGAATGGCTCGGTTGCCAATATCAATGCGATCAAGTCGGGCGCTCTGGAGTCCGGC
    TTTACGCAGTCAGACGTTGCCTATTGGGCCTATAACGGCACCGGCCTTTATGATGGCAAGGGCAAGGTGG
    AAGATTTGCGCCTTCTGGCGACGCTTTACCCGGAAACGATCCATATCGTTGCGCGTAAGGATGCAAACAT
    CAAATCGGTCGCAGACCTGAAAGGCAAGCGCGTTTCGCTGGATGAGCCGGGTTCTGGCACCATCGTCGAT
    GCGCGTATCGTTCTTGAAGCCTACGGCCTCACGGAAGACGATATCAAGGCTGAACACCTGAAGCCGGGAC
    CGGCAGGCGAGAGGCTGAAAGATGGTGCGCTGGACGCCTATTTCTTTGTGGGCGGCTATCCGACGGGCGC
    AATCTCGGAACTGGCCATCTCGAACGGTATTTCGCTCGTTCCGATCTCCGGGCCGGAAGCGGACAAGATT
    CTGGAGAAATATTCCTTCTTCTCGAAGGATGTGGTTCCTGCCGGAGCCTATAAGGACGTGGCGGAAACAC
    CGACCCTTGCCGTTGCCGCACAGTGGGTGACGAGCGCCAAGCAGCCGGACGACCTCATCTATAACATCAC
    CAAGGTTCTCTGGAACGAGGATACACGCAAGGCACTCGATGCGGGCCATGCGAAGGGCAAGCTCATCAAG
    CTCGATAGTGCGACGAGCAGCCTCGGTATTCCGCTGCATCCCGGCGCAGAACGCTTTTACAAGGAAGCGG
    GCGTGCTGAAATAATCCCTCAATGATCGGTTCCTGATATCTTATTCCGAATTGAAGGGTGACATTGCGGC
    AGCTCGTTATGCGCGCTGCTGCGCTCCCGTTTTCCAGAGCGGTTCCGGTTAGAACGGAATCGTTGGAACC
    GCTCTATCTCTTTGTTTTTACGCATTATCCGACGCAAAACCGTTTCACGCTTTTGCTGGAAATGCTCTAG
    CCTATTGAAATGCACGACCGGCAAAGTGGAGTTGGCCCGCATGACAGAAGAACAAAATGCAAAGCTT
  • Protein Sequence : Show Sequence
    >AAA22993.1 cell surface protein precursor [Brucella abortus]
    MKFGSKIRRLAVAAVAGAIALGASFAVAQAPTFFRIGTGGTAGTYYPIGGLIANAISGAGEKGVPGLVAT
    AVSSNGSVANINAIKSGALESGFTQSDVAYWAYNGTGLYDGKGKVEDLRLLATLYPETIHIVARKDANIK
    SVADLKGKRVSLDEPGSGTIVDARIVLEAYGLTEDDIKAEHLKPGPAGERLKDGALDAYFFVGGYPTGAI
    SELAISNGISLVPISGPEADKILEKYSFFSKDVVPAGAYKDVAETPTLAVAAQWVTSAKQPDDLIYNITK
    VLWNEDTRKALDAGHAKGKLIKLDSATSSLGIPLHPGAERFYKEAGVLK
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. abortus DNA vaccine expressing BCSP31, SOD and L7/L12
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.662
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
6. Bfr from B. abortus S19
  • Gene Name : Bfr from B. abortus S19
  • Sequence Strain (Species/Organism) : Brucella abortus S19
  • VO ID : VO_0010907
  • NCBI Gene ID : 6326162
  • NCBI Protein GI : 189022832
  • Locus Tag : BAbS19_II06320
  • Genbank Accession : CP000888
  • Protein Accession : YP_001932573
  • Taxonomy ID : 430066
  • Chromosome No : 2
  • Gene Starting Position : 673149
  • Gene Ending Position : 673634
  • Gene Strand (Orientation) : -
  • Protein Name : Bacterioferritin
  • Protein pI : 4.42
  • Protein Weight : 17971.98
  • Protein Length : 161
  • DNA Sequence : Show Sequence
    >NC_010740.1:673149-673634 Brucella abortus S19 chromosome 2, complete sequence
    CTTACTCAGCTTCGTCGGCGGGCGCCGCGTTAAGCTGGCCATAGCGTTCTCCGCCGATCTTGGCGAGAAG
    GTCAAGCTGGGTTTCAAGGAAGTCGATATGGCCTTCTTCATCGGCCAGAAGTTCGTCGAAAAGCTGCTTC
    GACACATAGTCGCCGAGCTTGTCGCAGATTTCGCGCGATTCCTTATACGAAGCGCGAGCGTCATATTCAC
    CCTTGAGGTCAGCTTCGAGAACTTCCTTCACATTCTGGCCAATGCGCAACGGCGAAACGGTCTGGAGGTT
    CGGAAAGCCTTCAAGGAAGATAATGCGATCAATCAGCTTGTCGGCGTGATGCATTTCCTCGATGGATTCC
    TCGCGTTCCTTCTTTGCAAGGCGCGTGTAACCCCAATCGTTGAGAAGACGGTAGTGCAGCCAATACTGGT
    TTACCGCACCGAGCTCAAGAAACAGTGCCTCGTTAAGCCGCTCGATGACCTTTGGTTCGCCTTTCA
    
    
  • Protein Sequence : Show Sequence
    >YP_001932573.1 Bacterioferritin [Brucella abortus S19]
    MKGEPKVIERLNEALFLELGAVNQYWLHYRLLNDWGYTRLAKKEREESIEEMHHADKLIDRIIFLEGFPN
    LQTVSPLRIGQNVKEVLEADLKGEYDARASYKESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDL
    LAKIGGERYGQLNAAPADEAE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Following two intragastric immunizations in BALB/c mice, the Yersinia vectors harboring a DNA vaccine encoding BFR (P39) induced antigen-specific serum immunoglobulin and Th1-type responses among splenocytes. The best protection was conferred by a serotype O:9 strain carrying pCIP39, confirming the importance of the P39 T-cell antigen in this mechanism (Al-Mariri et al., 2002).
  • COG: COG2193P, under P: Inorganic ion transport and metabolism
  • Localization(Probability): Cytoplasmic
    (Prob.=0.997)
  • Adhesin Probability: 0.133
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
7. Bfr from B. melitensis biovar Abortus 2308
  • Gene Name : Bfr from B. melitensis biovar Abortus 2308
  • Sequence Strain (Species/Organism) : Brucella abortus 2308
  • VO ID : VO_0010968
  • NCBI Gene ID : 3828133
  • NCBI Protein GI : 489055925
  • Locus Tag : BAB_RS29555
  • Genbank Accession : JMRZ01000012
  • Protein Accession : WP_002966069
  • 3D structure: PDB ID : 3FVB
  • Taxonomy ID : 359391
  • Chromosome No : II
  • Gene Starting Position : 673934
  • Gene Ending Position : 674419
  • Gene Strand (Orientation) : -
  • Protein Name : bacterioferritin
  • Protein pI : 4.42
  • Protein Weight : 17971.98
  • Protein Length : 161
  • DNA Sequence : Show Sequence
    >NC_007624.1:673934-674419 Brucella melitensis biovar Abortus 2308 chromosome II, complete sequence, strain 2308
    CTTACTCAGCTTCGTCGGCGGGCGCCGCGTTAAGCTGGCCATAGCGTTCTCCGCCGATCTTGGCGAGAAG
    GTCAAGCTGGGTTTCAAGGAAGTCGATATGGCCTTCTTCATCGGCCAGAAGTTCGTCGAAAAGCTGCTTC
    GACACATAGTCGCCGAGCTTGTCGCAGATTTCGCGCGATTCCTTATACGAAGCGCGAGCGTCATATTCAC
    CCTTGAGGTCAGCTTCGAGAACTTCCTTCACATTCTGGCCAATGCGCAACGGCGAAACGGTCTGGAGGTT
    CGGAAAGCCTTCAAGGAAGATAATGCGATCAATCAGCTTGTCGGCGTGATGCATTTCCTCGATGGATTCC
    TCGCGTTCCTTCTTTGCAAGGCGCGTGTAACCCCAATCGTTGAGAAGACGGTAGTGCAGCCAATACTGGT
    TTACCGCACCGAGCTCAAGAAACAGTGCCTCGTTAAGCCGCTCGATGACCTTTGGTTCGCCTTTCA
    
    
  • Protein Sequence : Show Sequence
    >WP_002966069.1 MULTISPECIES: bacterioferritin [Brucella]
    MKGEPKVIERLNEALFLELGAVNQYWLHYRLLNDWGYTRLAKKEREESIEEMHHADKLIDRIIFLEGFPN
    LQTVSPLRIGQNVKEVLEADLKGEYDARASYKESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDL
    LAKIGGERYGQLNAAPADEAE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Brucella bacterioferritin is a protective antigen (Al-Mariri et al., 2001)
  • COG: COG2193P, under P: Inorganic ion transport and metabolism
  • Localization(Probability): Cytoplasmic
    (Prob.=0.997)
  • Adhesin Probability: 0.133
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
8. Bp26
  • Gene Name : Bp26
  • Sequence Strain (Species/Organism) : Brucella melitensis bv. 1 str. 16M
  • VO ID : VO_0010962
  • NCBI Gene ID : 1196247
  • NCBI Protein GI : 17986819
  • Locus Tag : BMEI0536
  • Genbank Accession : AE008917
  • Protein Accession : NP_539453
  • Taxonomy ID : 224914
  • Chromosome No : I
  • Gene Starting Position : 557728
  • Gene Ending Position : 558480
  • Gene Strand (Orientation) : -
  • Protein Name : immunogenic protein
  • Protein pI : 6.97
  • Protein Weight : 24369.69
  • Protein Length : 250
  • DNA Sequence : Show Sequence
    >NC_003317.1:557728-558480 Brucella melitensis bv. 1 str. 16M chromosome I, complete sequence
    TTTACTTGATTTCAAAAACGACATTGACCGATACGTTATAGCTGTTTTCGCCTGCGGCAATCGGCACGGA
    ATTGTCCGGTGCGGCTGCTAGCATGGTTCTGAACTGTCCGCGCGCAATTGGCATCGGCATGGGCGGGCGG
    CTCAGTTCACTGATTTCCACCACACGGCCAAGCCCCACGCCTGCAGCGTCGGCAAGCGTCTTCGCCTTGG
    CAATGGCATTGGCCACTGCGCGCTTGCGCGCCTCGTTGATCACGGCGGAGGGATTATCATTGACCAGGTT
    CAAATCACCGCCCTGATTAACACCGAGCGTGACGGATTCATCCAAAATTTTTCCAACATTGGCCAGTTCG
    CGCACGCGAACCGTGAGACTGGTGGATACAGAATAGCCGGTGATGGTAGGCTCTTTCAGGTTGTTCTTGT
    CGTCAGGATAGACATAAATCGGCTGGATATTGATGCCGCCTGTCTGGAGATCGCGATCTTCGATGCCGGC
    CTTCTTCATGGCATCGAGCACTTTTGTCATGGCTTCATTATTCGCGGTCATGGCTTCGCGCGCGGTCTTT
    GCCTGGCGTAGCACCGAGAGATTGAGAATGGCCATATCGGGCGAGGCCGTCATCATGCCTTCCCCGGTGA
    CGGCGATGCGCGCGGGCTGCGTCGTCATCTGATTCTCCTGTGCGAAAGCGGGCAGGCTGAAAGCGCCGAC
    GAGCATGATTGTGGAAAATGAGGCTGCGAGAAAATTGCTAGCACGAGTGTTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_539453.1 immunogenic protein [Brucella melitensis bv. 1 str. 16M]
    MNTRASNFLAASFSTIMLVGAFSLPAFAQENQMTTQPARIAVTGEGMMTASPDMAILNLSVLRQAKTARE
    AMTANNEAMTKVLDAMKKAGIEDRDLQTGGINIQPIYVYPDDKNNLKEPTITGYSVSTSLTVRVRELANV
    GKILDESVTLGVNQGGDLNLVNDNPSAVINEARKRAVANAIAKAKTLADAAGVGLGRVVEISELSRPPMP
    MPIARGQFRTMLAAAPDNSVPIAAGENSYNVSVNVVFEIK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : This is a protective antigen (Yang et al., 2007).
  • COG: COG2968S, under S: Function unknown
  • Localization(Probability): Periplasmic
    (Prob.=1)
  • Adhesin Probability: 0.491
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
9. cobB
  • Gene Name : cobB
  • Sequence Strain (Species/Organism) : Brucella abortus 2308
  • NCBI Gene ID : 3787893
  • NCBI Protein GI : 489054238
  • Locus Tag : BAB_RS22225
  • Genbank Accession : JMRZ01000005
  • Protein Accession : WP_002964414
  • Taxonomy ID : 359391
  • Chromosome No : I
  • Gene Starting Position : 1271743
  • Gene Ending Position : 1273053
  • Gene Strand (Orientation) : -
  • Protein Name : hydrogenobyrinate a,c-diamide synthase
  • Protein pI : 6.89
  • Protein Weight : 44156.43
  • Protein Length : 436
  • Protein Note : responsible for the amidation of carboxylic groups at position A and C of cobyrinic acid or hydrogenobrynic acid
  • DNA Sequence : Show Sequence
    >NC_007618.1:1271743-1273053 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
    CTCACGCCGCTTCTCCGCTAAAATCAATGACATGCATGAAGGAGCCGGAGACGGAACCAACCCGCAAGCC
    CGCTTCGCCAAGGTTCTCGCCCGATGCATCGCGCACCCGGAACAGGCGGTCGGCCTTTTCTTCCCGCACG
    ATGCTTGCATAATGGAATTCATGCGCTTTCAAAGGCATGTCCCACGGCAATCCGCCAAGCGGCTCCAGCA
    GGCGATAGCCAAGATGCAGTTTCCGCCTGGCAAAGCTCGTTTCCAATGGCAAAAGCCCCAGCATGGGATG
    GTGAACGCCTGCCGCATCCTCCAGTGTTTTCCCGAGGACCATATAGCCGCCGCACTCGCCATAGACCGTG
    ACGCCACGCGCGGCAGCGTCCCCTATCGCCGTGCGGAAACGGGATGCACCGGCCAATCGTTGCGCATGAA
    GTTCTGGATAACCACCGGGAAGATAGATTGCATCCGCATCTGCCTTCGGTGCTTCATCTGCCAGCGGGGA
    AAAGAAAGAGATTTCCGCACCCCGCCTGCGCCAGCCTTCAAAAAGATGCATATAGGCAAAAGCAAAGGCA
    TCGTCCCGCGCCACGGCAATGCGGTTTCCAAGCGGTTTCAGACGCGCGACATTGGCCATGGCGTCATAGC
    GCTTCGGGCGTAGCCAGATGGTCTGAAGCGCATCCATGTCGATATGCGCTTCCATCACATCGGCCGCTTG
    TTCGAGAAAGCTTTCAAGACCGGCATGTTCGTCCGCCTGCACCAGCCCCAGATGCCTTTCCGGCAAGGAA
    AGTGCCGGATCTCGCGGCAGCGCGCCCAGAACCGGGACGCCAAGGGGTGCCAGAGCGCCCCGCAGCATGG
    CTTCATGGCGGGGACTTCCGACACGATTGAGAATGACACCCTCAATCAGCACATCCTTGCGAAACTGGCT
    GAAACCCCACACCAGCGCCGCGATGGAGTGGGATTGCCGGGCGCAATCCACCACCAGCACGACTGGCAAA
    TCCAGAAGCCGCGCCAGATCGGCAGAAGAGCCCTTACCGTCAATCGCCCCGTCGAAAAGCCCCATCATGC
    CTTCGGCGACAAGAACACGCGCGCCGCTTTCCGTCATGCGGGAGGAAAGCGCACTGATGAGTTCCGGTCG
    CATGGCCCAGGGGTCGAGATTGAAACAATCCACGCCACTCGCCGCCCTGTGATAGGCGGGGTCGATATAA
    TCCGGCCCGGCCTTCACCGGCGCAAGCACCTCGCCCCTGCGTTTCAGGGCGCGCAACAAACCCAAGGTCA
    CGGTCGTCTTGCCCGACCCGGAGGCCGGTGCGGCAATCATGAATCCCTTCA
    
    
  • Protein Sequence : Show Sequence
    >WP_002964414.1 MULTISPECIES: hydrogenobyrinate a,c-diamide synthase [Brucella]
    MKGFMIAAPASGSGKTTVTLGLLRALKRRGEVLAPVKAGPDYIDPAYHRAASGVDCFNLDPWAMRPELIS
    ALSSRMTESGARVLVAEGMMGLFDGAIDGKGSSADLARLLDLPVVLVVDCARQSHSIAALVWGFSQFRKD
    VLIEGVILNRVGSPRHEAMLRGALAPLGVPVLGALPRDPALSLPERHLGLVQADEHAGLESFLEQAADVM
    EAHIDMDALQTIWLRPKRYDAMANVARLKPLGNRIAVARDDAFAFAYMHLFEGWRRRGAEISFFSPLADE
    APKADADAIYLPGGYPELHAQRLAGASRFRTAIGDAAARGVTVYGECGGYMVLGKTLEDAAGVHHPMLGL
    LPLETSFARRKLHLGYRLLEPLGGLPWDMPLKAHEFHYASIVREEKADRLFRVRDASGENLGEAGLRVGS
    VSGSFMHVIDFSGEAA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice given BAB1_1316 (CobB) plus adjuvant could provide protection against virulent B. abortus infection, similarly with the known protective antigen Cu-Zn SOD and the license vaccine S19 (Fu et al., 2012).
  • Related Vaccine(s): Recombinant B. abortus CobB protein with CFA/IFA adjuvant
  • Localization(Probability): Cytoplasmic
    (Prob.=0.997)
  • Adhesin Probability: 0.101
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
10. DnaK
  • Gene Name : DnaK
  • Sequence Strain (Species/Organism) : Brucella abortus bv. 1 str. 9-941
  • VO ID : VO_0010970
  • NCBI Gene ID : 3341115
  • NCBI Protein GI : 62290965
  • Locus Tag : BruAb1_2100
  • Genbank Accession : AE017223
  • Protein Accession : YP_222758
  • Taxonomy ID : 262698
  • Chromosome No : I
  • Gene Starting Position : 2066035
  • Gene Ending Position : 2067948
  • Gene Strand (Orientation) : +
  • Protein Name : molecular chaperone DnaK
  • Protein pI : 4.59
  • Protein Weight : 63035.04
  • Protein Length : 637
  • Protein Note : heat shock protein 70; assists in folding of nascent polypeptide chains; refolding of misfolded proteins; utilizes ATPase activity to help fold; co-chaperones are DnaJ and GrpE; multiple copies in some bacteria
  • DNA Sequence : Show Sequence
    >NC_006932.1:2066035-2067948 Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence
    TATGGCTAAAGTTATTGGTATCGATCTGGGAACGACCAACTCCTGCGTTGCCGTCATGGACGGAAAGAAC
    GCGAAGGTCATTGAAAATGCAGAAGGTGCACGCACCACCCCTTCGATCATCGCCTTCACCGATGGTGACG
    AACGCCTCGCTGGTCAGCCTGCGAAGCGTCAGGCCGTCACCAACCCGGAAGGCACCCTTTTTGCCGTCAA
    GCGCCTGATTGGCCGTCGCTATGACGATCCGATGGTCACCAAGGACAAGGATCTTGTTCCTTACAAGATC
    GTCAAGGGCGACAATGGCGATGCCTGGGTCGAGGTGCACGGCAAGAAATATTCTCCGTCGCAGATCTCCG
    CTATGATCCTTCAGAAGATGAAGGAAACGGCTGAATCCTACCTTGGCGAAACCGTTACGCAGGCCGTCAT
    CACGGTTCCGGCCTACTTCAACGACGCCCAGCGTCAGGCCACCAAGGATGCCGGCAAGATCGCCGGTCTG
    GAAGTTCTGCGCATCATCAACGAGCCGACCGCGGCTGCGCTTGCCTATGGTCTCGACAAGAGCGAAGGCA
    AGACCATCGCTGTCTATGACCTTGGCGGCGGTACTTTCGACGTGTCGGTTCTGGAAATCGGCGACGGCGT
    TTTTGAAGTGAAGTCCACCAATGGCGACACGTTCCTTGGCGGTGAAGACTTCGATATTCGTCTGGTCGAA
    TATCTGGTTGCCGAGTTCAAGAAGGAAAGTGGCATCGACCTGAAGAACGACAAGCTTGCCCTGCAGCGCC
    TCAAGGAAGCTGCCGAAAAGGCCAAGATCGAACTGTCGTCCTCGCAGCAGACCGAAATCAACCTGCCGTT
    CATCACGGCTGACCAGACTGGCCCGAAGCATCTGGCGATCAAGCTGTCGCGCGCCAAGTTTGAAAGCCTG
    GTCGATGATCTCGTGCAGCGCACGGTCGAGCCGTGCAAGGCGGCGCTCAAGGATGCCGGCCTCAAGGCTG
    GCGAAATTGACGAAGTGGTTCTGGTCGGCGGCATGACCCGCATGCCCAAGATTCAGGAAGTCGTGAAGGC
    CTTCTTCGGCAAGGAACCGCACAAGGGCGTGAACCCGGATGAAGTCGTGGCCATGGGCGCGGCGATCCAG
    GGCGGCGTTTTGCAGGGCGACGTCAAGGACGTGCTGCTGCTCGACGTGACCCCGCTTTCGCTCGGCATTG
    AAACGCTGGGCGGCGTGTTCACCCGCCTGATCGAACGCAACACCACTATCCCGACCAAGAAGTCGCAGAC
    CTTCTCCACGGCTGAGGACAACCAGTCGGCCGTGACGATCCGCGTCTTCCAGGGCGAGCGTGAAATGGCA
    GCCGATAACAAGCTGCTTGGACAGTTCGACCTCGTTGGCATTCCGCCCGCACCGCGCGGTGTGCCGCAGA
    TCGAAGTGACCTTCGACATCGACGCCAACGGCATCGTCAACGTTTCGGCCAAGGATAAGGGTACCGGCAA
    GGAGCACCAGATCCGCATTCAGGCTTCGGGCGGCCTGAGCGATGCCGACATCGAAAAGATGGTCAAGGAC
    GCCGAAGCCAATGCCGAGGCCGACAAGAAGCGTCGTGAGAGCGTCGAAGCCAAGAATCAGGCCGAAAGCC
    TGGTCCATTCGACCGAAAAGTCGCTGGCCGAATATGGCGACAAGGTTTCGGCCGATGACAAGAAGGCCAT
    TGAGGATGCGATCGCAGCCCTCAAGACCTCGCTTGAAGGTGAAGACGCCGAGGATATCAAGGCGAAGACC
    CAGGCCCTTGCCGAAGTTTCCATGAAGCTTGGTCAGGCCATGTACGAAGCAGCGCAGGCTGCCGAAGGTG
    CGGGTGCCGAGGGCGGTGAACAGGCCTCTTCGTCCAAGGACGATGTGGTCGATGCCGACTACGAAGAAAT
    CGACGACAACAAGAAGTCGTCGTA
    
    
  • Protein Sequence : Show Sequence
    >YP_222758.1 molecular chaperone DnaK [Brucella abortus bv. 1 str. 9-941]
    MAKVIGIDLGTTNSCVAVMDGKNAKVIENAEGARTTPSIIAFTDGDERLAGQPAKRQAVTNPEGTLFAVK
    RLIGRRYDDPMVTKDKDLVPYKIVKGDNGDAWVEVHGKKYSPSQISAMILQKMKETAESYLGETVTQAVI
    TVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKSEGKTIAVYDLGGGTFDVSVLEIGDGV
    FEVKSTNGDTFLGGEDFDIRLVEYLVAEFKKESGIDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPF
    ITADQTGPKHLAIKLSRAKFESLVDDLVQRTVEPCKAALKDAGLKAGEIDEVVLVGGMTRMPKIQEVVKA
    FFGKEPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQT
    FSTAEDNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGK
    EHQIRIQASGGLSDADIEKMVKDAEANAEADKKRRESVEAKNQAESLVHSTEKSLAEYGDKVSADDKKAI
    EDAIAALKTSLEGEDAEDIKAKTQALAEVSMKLGQAMYEAAQAAEGAGAEGGEQASSSKDDVVDADYEEI
    DDNKKSS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Brucella DnaK is a protective antigen (Delpino et al., 2007b).
  • COG: COG0443O, under O: Posttranslational modification, protein turnover, chaperones
  • Localization(Probability): Cytoplasmic
    (Prob.=0.997)
  • Adhesin Probability: 0.326
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
11. Gap
  • Gene Name : Gap
  • Sequence Strain (Species/Organism) : Brucella abortus bv. 1 str. 9-941
  • VO ID : VO_0012375
  • NCBI Gene ID : 3340207
  • NCBI Protein GI : 62290600
  • Locus Tag : BruAb1_1713
  • Genbank Accession : AE017223
  • Protein Accession : YP_222393
  • Taxonomy ID : 262698
  • Chromosome No : I
  • Gene Starting Position : 1684720
  • Gene Ending Position : 1685727
  • Gene Strand (Orientation) : +
  • Protein Name : glyceraldehyde-3-phosphate dehydrogenase
  • Protein pI : 6.44
  • Protein Weight : 32765.28
  • Protein Length : 335
  • Protein Note : catalyzes the formation of 3-phospho-D-glyceroyl phosphate from D-glyceraldehyde 3-phosphate
  • DNA Sequence : Show Sequence
    >NC_006932.1:1684720-1685727 Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence
    AATGGCAGTTCGCGTCGCAATCAACGGTTTTGGCCGCATTGGCCGTAACATCCTTCGCGCCATCGTGGAA
    TCGGGGCGCACCGACATTCAGGTCGTCGCCATCAACGATCTCGGCCCGGTCGAAACCAACGCACATCTTC
    TGCGTTATGACAGCGTTCATGGCCGTTTCCCCAAGGAAGTGGAGGTTGCAGGCGATACGATCGATGTTGG
    CTACGGCCCGATCAAGGTTCATGCCGTCCGCAACCCGGCCGAACTGCCGTGGAAGGAAGAAAACGTCGAT
    ATCGCCCTTGAATGCACCGGCATTTTCACCTCGCGCGACAAGGCAGCACTTCATCTTGAAGCTGGCGCCA
    AGCGCGTCATCGTCTCCGCTCCCGCAGACGGTGCCGATCTCACCGTCGTCTATGGTGTCAACAACGACAA
    GCTGACGAAGGACCATCTGGTCATCTCCAACGCTTCGTGTACCACCAACTGCCTTGCGCCGGTGGCTCAG
    GTTCTCAACGATACTATCGGTATCGAAAAGGGCTTCATGACCACGATCCACTCCTATACGGGCGACCAGC
    CGACGCTGGACACCATGCACAAGGATCTCTACCGCGCCCGCGCCGCTGCCCTTTCCATGATCCCGACCTC
    GACGGGTGCGGCCAAGGCCGTCGGTCTCGTTCTGCCGGAACTGAAAGGCAAGCTCGACGGCGTTGCCATT
    CGCGTCCCGACCCCAAATGTCTCGGTCGTTGATCTCACCTTCATCGCCAAGCGTGAAACCACCGTTGAAG
    AAGTCAACAATGCGATCCGCGAAGCCGCCAATGGCCGCCTCAAGGGCATTCTCGGCTATACCGATGAGAA
    GCTCGTCTCGCACGACTTCAACCACGATTCCCATTCCTCGGTCTTCCACACCGACCAGACCAAGGTTATG
    GACGGCACCATGGTGCGTATCCTGTCGTGGTACGACAATGAATGGGGCTTCTCCAGCCGCATGAGCGACA
    CCGCCGTCGCTTTGGGCAAGCTGATCTG
    
    
  • Protein Sequence : Show Sequence
    >YP_222393.1 glyceraldehyde-3-phosphate dehydrogenase [Brucella abortus bv. 1 str. 9-941]
    MAVRVAINGFGRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHLLRYDSVHGRFPKEVEVAGDTIDVG
    YGPIKVHAVRNPAELPWKEENVDIALECTGIFTSRDKAALHLEAGAKRVIVSAPADGADLTVVYGVNNDK
    LTKDHLVISNASCTTNCLAPVAQVLNDTIGIEKGFMTTIHSYTGDQPTLDTMHKDLYRARAAALSMIPTS
    TGAAKAVGLVLPELKGKLDGVAIRVPTPNVSVVDLTFIAKRETTVEEVNNAIREAANGRLKGILGYTDEK
    LVSHDFNHDSHSSVFHTDQTKVMDGTMVRILSWYDNEWGFSSRMSDTAVALGKLI
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : GAPDH (Gap) associated with murine IL-12 gene in a DNA vaccine formulation partially protected mice against experimental infection (Rosinha et al., 2002b).
  • Localization(Probability): Cytoplasmic
    (Prob.=0.997)
  • Adhesin Probability: 0.361
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
12. IalB
  • Gene Name : IalB
  • Sequence Strain (Species/Organism) : Brucella melitensis bv. 1 str. 16M
  • VO ID : VO_0010967
  • NCBI Gene ID : 1197295
  • NCBI Protein GI : 17987867
  • Locus Tag : BMEI1584
  • Genbank Accession : AE008917
  • Protein Accession : NP_540501
  • Taxonomy ID : 224914
  • Chromosome No : I
  • Gene Starting Position : 1632893
  • Gene Ending Position : 1633414
  • Gene Strand (Orientation) : +
  • Protein Name : invasion protein B
  • Protein pI : 8.98
  • Protein Weight : 17016.04
  • Protein Length : 173
  • DNA Sequence : Show Sequence
    >NC_003317.1:1632893-1633414 Brucella melitensis bv. 1 str. 16M chromosome I, complete sequence
    TATGAAAAATTATCGTGCAATCGGTCTTGCATTCACGTTCACTGCCCTTTCCAGTCTTTCGGCCTTTGCA
    GCCTCCCTGCCCGGCGGAGCAAGCACCTTGCAGGAAACCTATCAGGACTGGACCGTGTCTTGCCAGTCGC
    AGAAGGATACAACAGCCTGCGTGATGCGTCAGGAGCAAAGCAGCGCCCAGGCCGGCCAGCGCGTTCTGAC
    TGCCGAGCTGCGCAACGTCGCCGGCGGCAAAGTTGACGGTGTGTTGCTGATGCCGTTCGGTCTTGATCTT
    GCCAAGGGCGCCTCGCTCAAGATTGATGACACCGCTGGGCCAAACCTCACCTTCTCCACCTGCCTGCCGC
    AGGGCTGCCTCGCGCCAGTGAGCTTCGATGCCAAGCAGGTTGCTGCGCTGAAATCCGGCACCAACATCAA
    TGTCACCACGACGGCGCTCAGCCCGAGCCAGCCGGTTGCCTTCAAGATTTCCCTGAAAGGCTTCGGTGCC
    GCGCTCGACCGCATTCAGGCATTGACCAAGTA
    
    
  • Protein Sequence : Show Sequence
    >NP_540501.1 invasion protein B [Brucella melitensis bv. 1 str. 16M]
    MKNYRAIGLAFTFTALSSLSAFAASLPGGASTLQETYQDWTVSCQSQKDTTACVMRQEQSSAQAGQRVLT
    AELRNVAGGKVDGVLLMPFGLDLAKGASLKIDDTAGPNLTFSTCLPQGCLAPVSFDAKQVAALKSGTNIN
    VTTTALSPSQPVAFKISLKGFGAALDRIQALTK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Brucella IalB is a protective antigen (Commander et al., 2007).
  • COG: COG5342R, under R: General function prediction only
  • Related Vaccine(s): B. melitensis DNA vaccine p-ialB
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.776
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
13. L7/L12
  • Gene Name : L7/L12
  • Sequence Strain (Species/Organism) : Brucella abortus RB51-AHVLA
  • NCBI Protein GI : 479804332
  • Other Database IDs : CDD:100102
  • Taxonomy ID : 1198700
  • Gene Strand (Orientation) : ?
  • Protein Name : 50S ribosomal protein L7/L12
  • Protein pI : 4.62
  • Protein Weight : 12562.32
  • Protein Length : 198
  • Protein Note : vaccine strain
  • Protein Sequence : Show Sequence
    >ENT73302.1 50S ribosomal protein L7/L12 [Brucella abortus RB51-AHVLA]
    MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDVVLADGGANKI
    NVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAGAKVELK
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Divalent DNA B. abortus Vaccine pcDNA3.1-L7/L12-Omp16
  • Localization(Probability): Unknown
    (Prob.=0.649)
  • Adhesin Probability: 0.329
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
14. Omp16
  • Gene Name : Omp16
  • Sequence Strain (Species/Organism) : Brucella abortus 2308
  • VO ID : VO_0010973
  • NCBI Gene ID : 3788229
  • NCBI Protein GI : 489056820
  • Locus Tag : BAB_RS24085
  • Genbank Accession : AM040264
  • Protein Accession : WP_002966947
  • Taxonomy ID : 359391
  • Chromosome No : I
  • Gene Starting Position : 1654432
  • Gene Ending Position : 1654938
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 10.24
  • Protein Weight : 17438.15
  • Protein Length : 168
  • Protein Annotation : Synonyms: Omp16, MotY
  • DNA Sequence : Show Sequence
    >NC_007618.1:1654432-1654938 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
    TTTACCGTCCGGCCCCGTTGAGAACGGTGACGGCGCGACGGTTCTGCGACCAGCATGTGTCGGCATCGCA
    GACGGCAACCGGGCGCTCATTACCGTAGGAAATGGTGCGCATGCGGTTGGTCGGCACACCGCGCGAAGCG
    AGGAAGTCGCGGGTGGCGGCAGCACGGCGCTGGCCAAGGGCGAGGTTGTACTCACGCGTGCCGCGCTCGT
    CGGCATGGCCTTCGATCGTGATCGAATACTGCGGATAACGCTGCAACCACTGGGCCTGCTTGGAAAGCGT
    CTGCTGCGCATCGGCGCGGATCAGCGACGAATCGAGATCGAAGAAGATGCGGTCGCCGACATTAACGGTG
    AAGTCCTGCGAGGAGCCCGGCGTTGCAGCGCCTGCACCGAGACCCAGATCACCGGCATTATTCGGAAGGT
    TCTTCTTTGACGCACAGCCGGCAACGGCGAGCGACATGAAAAGCGCAATAGCGATCGGGCTACGTGCAAT
    CGACTGGATACGGCGCA
    
    
  • Protein Sequence : Show Sequence
    >WP_002966947.1 MULTISPECIES: hypothetical protein [Brucella]
    MRRIQSIARSPIAIALFMSLAVAGCASKKNLPNNAGDLGLGAGAATPGSSQDFTVNVGDRIFFDLDSSLI
    RADAQQTLSKQAQWLQRYPQYSITIEGHADERGTREYNLALGQRRAAATRDFLASRGVPTNRMRTISYGN
    ERPVAVCDADTCWSQNRRAVTVLNGAGR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Brucella Omp16 is a protective antigen (Pasquevich et al., 2009).
  • COG: COG2885M, under M: Cell wall/membrane/envelope biogenesis
  • Related Vaccine(s): B. abortus DNA vaccine encoding RplL and Omp16
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.388
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
15. omp16
  • Gene Name : omp16
  • Sequence Strain (Species/Organism) : Brucella abortus RB51-AHVLA
  • NCBI Protein GI : 479804733
  • Other Database IDs : CDD:225439
    CDD:143586
  • Taxonomy ID : 1198700
  • Gene Strand (Orientation) : ?
  • Protein Name : outer membrane lipoprotein omp16
  • Protein pI : 10.24
  • Protein Weight : 18331.05
  • Protein Length : 247
  • Protein Note : vaccine strain
  • Protein Sequence : Show Sequence
    >ENT73703.1 outer membrane lipoprotein omp16 [Brucella abortus RB51-AHVLA]
    MRRIQSIARSPIAIALFMSLAVAGCASKKNLPNNAGDLGLGAGAATPGSSQDFTVNVGDRIFFDLDSSLI
    RADAQQTLSKQAQWLQRYPQYSITIEGHADERGTREYNLALGQRRAAATRDFLASRGVPTNRMRTISYGN
    ERPVAVCDADTCWSQNRRAVTVLNGAGR
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): Divalent DNA B. abortus Vaccine pcDNA3.1-L7/L12-Omp16
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.388
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
16. Omp19
  • Gene Name : Omp19
  • Sequence Strain (Species/Organism) : Brucella abortus 2308
  • VO ID : VO_0010972
  • NCBI Gene ID : 3788831
  • NCBI Protein GI : 489054833
  • Locus Tag : BAB_RS25135
  • Genbank Accession : AM040264
  • Protein Accession : WP_002964998
  • Taxonomy ID : 359391
  • Chromosome No : I
  • Gene Starting Position : 1877306
  • Gene Ending Position : 1877839
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 8.86
  • Protein Weight : 16412.87
  • Protein Length : 177
  • DNA Sequence : Show Sequence
    >NC_007618.1:1877306-1877839 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
    ATCAGCGCGACAGCGTCACGGCCTGCCCGCCGGTGGTCTGGCCATCGAAGCGGCCCTGTCCTGAAGAATA
    GAGCGAGGCAACCGTACCGCCGTTCGCATCGTAAAGGACGAGTTGCTTGCCATTGACGGCCCAGGAGGCA
    AGATTAGCCAGTTCACCGGGGCAGCGCAGCGGGCCTGCGCGATAGCCCTGGCCATATTTGGTCTGCGGCG
    TCGCGATCTTGCAGCTCTGACCACCAAGCGAGGCGTTCCAGACGCCAGCCACGGCGCCGGGCGTCAGGTC
    CGGTGCGGATGCAGGCGGCAGGCTTGCGACCTGTGTGCCGGATTGCGCGCTCATATCCGTGGAGGGCGCA
    TTGGGGAATTGTGTGGGAGAATCAAGATTGCCTTTCTGCACCGTGCCTGCCGGAACAGCATTGACCGGTG
    CAGGCGGCGGCGGAGGCGAAACATTATCGAGATTACCAAGCCGGGAGCTCTGGCACCCGGCCAGGACAAT
    GCCAGCCGCCGCGAGGCTGAGCAGACTTGCTTTTGAAATTCCCA
    
    
  • Protein Sequence : Show Sequence
    >WP_002964998.1 MULTISPECIES: hypothetical protein [Brucella]
    MGISKASLLSLAAAGIVLAGCQSSRLGNLDNVSPPPPPAPVNAVPAGTVQKGNLDSPTQFPNAPSTDMSA
    QSGTQVASLPPASAPDLTPGAVAGVWNASLGGQSCKIATPQTKYGQGYRAGPLRCPGELANLASWAVNGK
    QLVLYDANGGTVASLYSSGQGRFDGQTTGGQAVTLSR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Brucella Omp19 is a protective antigen (Pasquevich et al., 2009).
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.884
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
17. Omp25
  • Gene Name : Omp25
  • Sequence Strain (Species/Organism) : Brucella melitensis bv. 1 str. 16M
  • VO ID : VO_0010966
  • NCBI Gene ID : 1196960
  • NCBI Protein GI : 17987532
  • Locus Tag : BMEI1249
  • Genbank Accession : AE008917
  • Protein Accession : NP_540166
  • Taxonomy ID : 224914
  • Chromosome No : I
  • Gene Starting Position : 1297524
  • Gene Ending Position : 1298165
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 9.03
  • Protein Weight : 21696.72
  • Protein Length : 213
  • Protein Annotation : Reference: http://www.ncbi.nlm.nih.gov/pubmed/17049676
  • DNA Sequence : Show Sequence
    >NC_003317.1:1297524-1298165 Brucella melitensis bv. 1 str. 16M chromosome I, complete sequence
    ATTAGAACTTGTAGCCGATGCCGACGCGGAAATCCTGCGTGTCCAGCTTGTTGCGAACAGTCGTACCGGC
    CAGATCATAGTTCTTGTTGCCGTACTGGGTGTAACGGTACTCAACGCGGCCGAGGATGTTGTCCGTCAGC
    TTGGCTTCGAGACCGGCACCAGCCGTCCAACCCACGCGGAACTTGCTTTCGTCGTCCAAGCCGTTGTTAA
    GCTTGATCTGCGAACCGGCAATACCAGCCGTGAGGTACGGCATAACCGGGTTCAGGTCGTAGCCAACGCG
    GGCACGCAGCGAGCCTTCAAAGCCCTGCTTGACTTCCAGGCCGTCCTTGGACTTCTTGGCCCAGGAATAA
    CCTGCATCACCTTCAACACCGTATACGATCTGGTCCTGCTGGAAGTTCCAGCCAGCAAAGGCGCCAGCCT
    TCCAATCGTCAGGCTTGATGCTGCCAACGGTGCTGGTCTTGGCCTTGTTCCAGCCGTAGCCAAGGTAAAG
    ACCGGTATAGCCACCAGCCCAGCTATACTGGGGAGCTACTTCAACCGGAGCCGGAACCGGAGGCTGTTCC
    TGGATGGCGTCGGCAGCAAAAGCGGTCGCAGAGAACGGCAGCAACGCAGCCGAGACGATTACGAGAGACT
    TAAGAGTGCGCA
    
    
  • Protein Sequence : Show Sequence
    >NP_540166.1 hypothetical protein BMEI1249 [Brucella melitensis bv. 1 str. 16M]
    MRTLKSLVIVSAALLPFSATAFAADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIK
    PDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAG
    SQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDFRVGIG
    YKF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Brucella Omp25 is a protective antigen (Commander et al., 2007).
  • Additional Molecule Role : Virmugen
  • Additional Molecule Role Annotation : A omp25 mutant is attenuated and provides protection against challenge in mice (Edmonds et al., 2002).
  • COG: COG3637M, under M: Cell wall/membrane/envelope biogenesis
  • Related Vaccine(s): B. melitensis DNA vaccine p-Omp25 , Brucella melitensis omp25 mutant vaccine
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.574
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
18. Omp31
  • Gene Name : Omp31
  • Sequence Strain (Species/Organism) : Brucella abortus 2308
  • VO ID : VO_0010939
  • NCBI Gene ID : 3788834
  • NCBI Protein GI : 489054549
  • Locus Tag : BAB_RS23735
  • Genbank Accession : AM040264
  • Protein Accession : WP_002964719
  • Taxonomy ID : 359391
  • Chromosome No : I
  • Gene Starting Position : 1583642
  • Gene Ending Position : 1584427
  • Gene Strand (Orientation) : +
  • Protein Name : membrane protein
  • Protein pI : 4.74
  • Protein Weight : 25591.47
  • Protein Length : 261
  • DNA Sequence : Show Sequence
    >NC_007618.1:1583642-1584427 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
    CATGTTTAGCTTAAAAGGGACTGTTATGAAAACCGCACTTCTTGCATCCGTCGCAATGTTGTTCACAAGC
    TCGGCTATGGCTGCCGACATCATCGTTGCTGAACCGGCACCCGTTGCAGTCGACACGTTCTCTTGGACTG
    GCGGCTATATTGGTATCAATGCTGGTTACGCTGGCGGCAAGTTCAAGCATCCGTTCTCAGGCATCGAGCA
    GGATGGGGCCCAAGATTTTTCAGGTTCGCTCGACGTCACGGCCAGCGGCTTTGTTGGCGGCGTTCAGGCC
    GGTTATAACTGGCAGCTTGCCAACGGCCTCGTGCTTGGTGGCGAAGCTGACTTCCAGGGCTCGACGGTTA
    AGAGCAAGCTTGTTGACAACGGTGACCTCTCCGATATCGGCGTTGCAGGCAACCTCAGCGGCGACGAAAG
    CTTCGTCCTCGAGACCAAGGTTCAGTGGTTTGGAACGGTGCGTGCGCGCCTCGGCTTCACCCCGACTGAA
    CGCCTGATGGTCTATGGTACCGGTGGTTTGGCCTATGGTAAGGTCAAGACGTCGCTTAGCGCCTATGACG
    ATGGTGAATCGTTCAGCGCCGGAAACTCTAAGACCAAGGCTGGCTGGACGCTTGGTGCAGGTGTAGAATA
    CGCCGTCACCAACAATTGGACCCTGAAGTCGGAATACCTCTACACCGACCTCGGCAAGCGTTCCTTCAAT
    TACATTGATGAAGAAAACGTCAATATTAACATGGAAAACAAGGTGAACTTCCACACCGTCCGCCTCGGTC
    TGAACTACAAGTTCTA
    
    
  • Protein Sequence : Show Sequence
    >WP_002964719.1 MULTISPECIES: porin family protein [Brucella]
    MFSLKGTVMKTALLASVAMLFTSSAMAADIIVAEPAPVAVDTFSWTGGYIGINAGYAGGKFKHPFSGIEQ
    DGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKSKLVDNGDLSDIGVAGNLSGDES
    FVLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY
    AVTNNWTLKSEYLYTDLGKRSFNYIDEENVNINMENKVNFHTVRLGLNYKF
    
    
  • Molecule Role : Protective antigen
  • COG: COG3637M, under M: Cell wall/membrane/envelope biogenesis
  • Related Vaccine(s): B. melitensis 16M DNA vaccine expressing Omp31
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.745
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
19. omp31
  • Gene Name : omp31
  • Sequence Strain (Species/Organism) : Brucella melitensis bv. 1 str. 16M
  • NCBI Protein GI : 61229373
  • Other Database IDs : CDD:226163
  • Taxonomy ID : 224914
  • Gene Strand (Orientation) : ?
  • Protein Name : 31 kDa outer-membrane immunogenic protein
  • Protein pI : 5.06
  • Protein Weight : 24732.46
  • Protein Length : 343
  • Protein Note : biovar: 1 str. 16M
  • Protein Sequence : Show Sequence
    >sp|P0A3U4.1|OM31_BRUME RecName: Full=31 kDa outer-membrane immunogenic protein; Flags: Precursor
    MKSVILASIAAMFATSAMAADVVVSEPSAPTAAPVDTFSWTGGYIGINAGYAGGKFKHPFSSFDKEDNEQ
    VSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARL
    GYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLGAGAEYAINNNWTLKSEYLYTDL
    GKRNLVDVDNSFLESKVNFHTVRVGLNYKF
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. melitensis DNA vaccine pCI-Omp31 , B. melitensis DNA vaccine pCIBLSOmp31 encoding BLSOmp31 (fusion protein)
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.836
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
20. ORF
  • Gene Name : ORF
  • VO ID : VO_0010927
  • NCBI Nucleotide GI : 599653
  • NCBI Protein GI : 599654
  • Protein Accession : CAA86936.1
  • 3D structure: PDB ID : 1DI0
  • Other Database IDs : CDD:237096
    CDD:187741
    GOA:P61711
    InterPro: IPR002180
    PDB: 1DI0
    PDB: 1T13
    PDB: 1XN1
    UniProtKB/UniProt: P61711
  • Taxonomy ID : 235
  • Gene Strand (Orientation) : ?
  • Protein pI : 7.41
  • Protein Weight : 16119.15
  • Protein Length : 197
  • Protein Note : riboflavin synthase subunit beta; Provisional
  • DNA Sequence : Show Sequence
    >gi|599653|emb|Z46864.1| B.abortus gene for open reading frame
    GAATTCCGATCAGTGCATAGTTTCCGCGTGCTCGCGCAATGGTGCGCGGGCTTGTTCTCGGGGCGGGGTG
    AAACTCCCCACCGGCGGTATGAAAAGCAATTTTCAAGCCCGCGAGCGCCTGAAATGGAAGCCGATTCGCA
    TGCCATTTCAGGGTCAGCAGATCCGGTGAGATGCCGGAGCCGACGGTTAAAGTCCGGATGGAAGAGAGCG
    AATGAGCGTCACGATTGCGCCTTCCGGCGTCGTTCTTGCGTTCTTTTGTGCGCCCTGATTCTAGTTTCGT
    GAGGAACCTATGAACCAAAGCTGTCCGAACAAGACATCCTTTAAAATCGCATTCATTCAGGCCCGCTGGC
    ACGCCGACATCGTTGACGAAGCGCGCAAAAGCTTTGTCGCCGAACTGGCCGCAAAGACGGGTGGCAGCGT
    CGAGGTAGAGATATTCGACGTGCCGGGTGCATATGAAATTCCCCTTCACGCCAAGACATTGGCCAGAACC
    GGGCGCTATGCAGCCATCGTCGGTGCGGCCTTCGTGATCGACGGCGGCATCTATCGTCATGATTTCGTGG
    CGACGGCCGTTATCAACGGCATGATGCAGGTGCAGCTTGAAACGGAAGTGCCGGTGCTGAGCGTCGTGCT
    GACGCCGCACCATTTCCATGAAAGCAAGGAGCATCACGACTTCTTCCATGCTCATTTCAAGGTGAAGGGC
    GTGGAAGCGGCCCATGCCGCCTTGCAGATCGTGAGCGAGCGCAGCCGCATCGCCGCGCTTGTCTGACTAA
    CCCTCTATAATACGCCCGCAATGGGTATAAATGTCGAATTC
  • Protein Sequence : Show Sequence
    >CAA86936.1 ORF [Brucella abortus]
    MNQSCPNKTSFKIAFIQARWHADIVDEARKSFVAELAAKTGGSVEVEIFDVPGAYEIPLHAKTLARTGRY
    AAIVGAAFVIDGGIYRHDFVATAVINGMMQVQLETEVPVLSVVLTPHHFHESKEHHDFFHAHFKVKGVEA
    AHAALQIVSERSRIAALV
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : This gene was originally isolated from a lambda gt11 expression library probed with sera from Brucella-infected sheep. Sequence analysis of the cloned gene revealed the presence of an open reading frame of 158 amino acids encoding a protein of 17.3 kDa (Hemmen et al., 1995). It was later identified as a cytoplasmic protein lumazine synthase (Goldbaum et al., 1999). This gene can be used for diagnosis (Hemmen et al., 1995; Goldbaum et al., 1999) and vaccine development (Velikovsky et al., 2002).
  • Related Vaccine(s): B. abortus pcDNA-BLS , B. melitensis DNA vaccine pCIBLSOmp31 encoding BLSOmp31 (fusion protein)
  • Localization(Probability): Cytoplasmic
    (Prob.=0.997)
  • Adhesin Probability: 0.353
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
21. P39 from Brucella abortus
  • Gene Name : P39 from Brucella abortus
  • Sequence Strain (Species/Organism) : Brucella abortus bv. 1 str. 9-941
  • NCBI Protein GI : 68067499
  • Other Database IDs : CDD:224567
  • Taxonomy ID : 262698
  • Gene Strand (Orientation) : ?
  • Protein Name : Probable sugar-binding periplasmic protein
  • Protein pI : 5.06
  • Protein Weight : 44330.68
  • Protein Length : 589
  • Protein Note : biovar: 1 str. 9-941
  • Protein Sequence : Show Sequence
    >sp|O06875.3|SP39_BRUAB RecName: Full=Probable sugar-binding periplasmic protein; AltName: Full=Immunogenic 39 kDa protein; AltName: Full=P39; Flags: Precursor
    MHKLLKLAAMGTAACALLAGMAPVANAQEKQNVEVLHWWTSGGEASALEVLKKDLESKGISWTDMPVAGG
    GGTEAMTVLRARVTAGNAPTAVQMLGFDIRDWAEQGALGNLDTVASKEGWEKVIPAPLQEFAKYDGHWIA
    APVNIHSTNWMWINKAALDKAGGKEPTNWDELIALLDNFKAQGITPIAHGGQPWQDATIFDAVVLSFGPD
    FYKKAFIDLDPEALGSDTMKQAFDRMSKLRTYVDDNFSGRDWNLASAMVIEGKAGVQFMGDWAKGEFLKA
    GKKPGEDFVCMRYPGTQGAVTFNSDMFAMFKVSEDKVPAQLEMASAIESPAFQSAFNVVKGSAPARTDVP
    DTAFDACGKKAIADVKEANSKGTLLGSMAHGYANPAAVKNAIYDVVTRQFNGQLSSEDAVKELVAAVEAA
    K
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): B. abortus DNA vaccine pcDNA3.1-p39-L7/L12 encoding p39-L7/L12 fusion protein
  • Localization(Probability): Periplasmic
    (Prob.=0.976)
  • Adhesin Probability: 0.567
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
22. PALFn
  • Gene Name : PALFn
  • Sequence Strain (Species/Organism) : Bacillus anthracis
  • NCBI Protein GI : AKB95640
  • Other Database IDs : CDD:284994
    CDD:281492
    CDD:285037
    CDD:286266
    CDD:238144
  • Taxonomy ID : 32630
  • Protein Name : PALFn
  • Protein pI : 5.69
  • Protein Weight : 169963.43
  • Protein Length : 1613
  • Protein Note : derived from Bacillus anthracis
  • Protein Sequence : Show Sequence
    >AKB95640.1 PALFn [synthetic construct]
    MSYYHHHHHHDYDIPTTENLYFQGAMDPEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGD
    LSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGR
    LYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDNDG
    IPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEAR
    HPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSA
    GFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLA
    TIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATY
    NFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFG
    FNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNVTNIYTVLDKIKLNAKMNILIRDKRFHYDRNN
    IAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDG
    KTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIGGGGGSGG
    GGSAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVP
    SDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDY
    VENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE
    QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLSRYEKWEKIKQH
    YQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRD
    SLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQ
    NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVD
    INERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDT
    KIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG
    RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAG
    YLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFIN
    DQIKFIINS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Suryanarayana et al., 2016)
  • Localization(Probability): Unknown
    (Prob.=0.548)
  • Adhesin Probability: 0.326
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
23. RplL
  • Gene Name : RplL
  • Sequence Strain (Species/Organism) : Brucella abortus 2308
  • VO ID : VO_0010908
  • NCBI Gene ID : 3788918
  • NCBI Protein GI : 489054195
  • Locus Tag : BAB_RS21965
  • Genbank Accession : AM040264
  • Protein Accession : WP_002964371
  • Taxonomy ID : 359391
  • Chromosome No : I
  • Gene Starting Position : 1229918
  • Gene Ending Position : 1230292
  • Gene Strand (Orientation) : -
  • Protein Name : 50S ribosomal protein L7/L12
  • Protein pI : 4.49
  • Protein Weight : 11356.05
  • Protein Length : 124
  • Protein Note : present in two forms; L12 is normal, while L7 is aminoacylated at the N-terminal serine; the only multicopy ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two L12 dimers bind L10; critically important for translation efficiency and fidelity; stimulates GTPase activity of translation factors
  • DNA Sequence : Show Sequence
    >NC_007618.1:1229918-1230292 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
    CTTACTTGAGTTCAACCTTGGCGCCAGCAGCTTCGAGCTGTGCCTTGATCTTCTCAGCTTCGTCCTTCGA
    GGCGCCTTCCTTGACAGCCTTCGGAGCGCCTTCGACCAGGTCCTTGGCTTCCTTGAGGCCGAGACCGGTG
    AGTGCGCGCACTTCCTTGATCACGTTGATCTTGTTAGCGCCGCCGTCAGCGAGAACGACGTCGAATTCGG
    TCTTTTCTTCTGCGGCAGCAGCAGGGGCAGCGCCACCGGCAGCAGCAACAGCGACCGGAGCAGCAGCCGA
    AACGCCCCACTTCTCTTCGAGAAGCTTGGACAGCTCAGCGGCTTCCAGAACGGTCAGGGCCGAAAGGTCT
    TCAACGATCTTTGCGAGATCAGCCA
    
    
  • Protein Sequence : Show Sequence
    >WP_002964371.1 MULTISPECIES: 50S ribosomal protein L7/L12 [Brucella]
    MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDVVLADGGANKI
    NVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAGAKVELK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Study was designed to evaluate the immunogenicity and the protective efficacy of a divalent fusion DNA vaccine encoding both the Brucella abortus L7/L12 protein (ribosomal protein, rplL) and Omp16 protein (outer membrane lipoprotein). This divalent DNA vaccine induced a significant level of protection against challenge with the virulent B. abortus in BALB/c mice (Luo et al., 2006b).
  • Related Vaccine(s): B. abortus DNA vaccine encoding RplL and Omp16
  • Localization(Probability): Unknown
    (Prob.=0.649)
  • Adhesin Probability: 0.329
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
24. SodC from B. abortus strain 2308
  • Gene Name : SodC from B. abortus strain 2308
  • Sequence Strain (Species/Organism) : Brucella abortus 2308
  • VO ID : VO_0010856
  • NCBI Gene ID : 3827840
  • NCBI Protein GI : 489062065
  • Locus Tag : BAB_RS28905
  • Genbank Accession : AM040265
  • Protein Accession : WP_002972093
  • 3D structure: PDB ID : 2AQM
  • Taxonomy ID : 359391
  • Chromosome No : II
  • Gene Starting Position : 534068
  • Gene Ending Position : 534589
  • Gene Strand (Orientation) : +
  • Protein Name : superoxide dismutase [Cu-Zn]
  • Protein pI : 6.74
  • Protein Weight : 16741.77
  • Protein Length : 173
  • DNA Sequence : Show Sequence
    >NC_007624.1:534068-534589 Brucella melitensis biovar Abortus 2308 chromosome II, complete sequence, strain 2308
    GATGAAGTCCTTATTTATTGCATCGACAATGGTGCTTATGGCTTTTCCGGCTTTCGCAGAAAGCACGACG
    GTAAAAATGTATGAGGCGCTGCCGACCGGACCGGGTAAAGAAGTTGGCACCGTGGTCATTTCCGAAGCCC
    CGGGCGGGCTGCACTTCAAGGTGAATATGGAAAAGCTGACGCCGGGCTATCATGGCTTTCATGTTCACGA
    AAATCCAAGCTGCGCTCCGGGAGAAAAAGACGGCAAGATCGTACCGGCTCTTGCTGCCGGCGGGCATTAT
    GATCCGGGTAATACCCATCACCATTTAGGACCTGAAGGTGATGGACATATGGGCGATTTGCCACGCCTGA
    GCGCCAATGCTGACGGCAAGGTGAGTGAAACCGTTGTCGCTCCACATCTCAAGAAATTGGCGGAAATCAA
    GCAGCGTTCTTTGATGGTCCATGTCGGAGGGGATAATTATTCCGATAAGCCTGAGCCGCTTGGTGGCGGT
    GGTGCCCGTTTTGCCTGCGGCGTGATCGAATA
    
    
  • Protein Sequence : Show Sequence
    >WP_002972093.1 MULTISPECIES: superoxide dismutase [Cu-Zn] [Brucella]
    MKSLFIASTMVLMAFPAFAESTTVKMYEALPTGPGKEVGTVVISEAPGGLHFKVNMEKLTPGYHGFHVHE
    NPSCAPGEKDGKIVPALAAGGHYDPGNTHHHLGPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIK
    QRSLMVHVGGDNYSDKPEPLGGGGARFACGVIE
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : IMMUNOGENICITY: Induces antigen-specific Th1 immune response, as indicated by the specific induction of serum IgG2a, but not IgG1, antibodies and by the secretion of IFN-γ, but not IL-4, by the Cu/Zn SOD-stimulated splenocytes. Has been used for vaccine development (Vemulapalli et al., 2000; He et al., 2002; Onate et al., 2003).

    MUTATION: An isogenic sodC mutant constructed from B abortus 2308 by gene replacement exhibited much greater susceptibility to killing by exogenous O(2)(-) than the parental 2308 strain, supporting a role for SodC in protecting this bacterium from O(2)(-) stress. The B abortus sodC mutant was much more sensitive to killing by cultured resident peritoneal macrophages from C57BL6J mice than 2308, and its attenuation in cultured murine macrophages was enhanced when these phagocytes were treated with gamma interferon. The attenuation of the B abortus sodC mutant in both resting and IFN-gamma-activated macrophages was alleviated in the presence of the NADPH oxidase inhibitor apocynin. Consistently, the B abortus sodC mutant also displayed significant attenuation in infected C57BL6J mice compared to the parental strain. These findings suggest that SodC protects B abortus 2308 from the respiratory burst of host macrophages (Gee et al., 2005).
  • COG: COG2032P, under P: Inorganic ion transport and metabolism
  • Related Vaccine(s): B. abortus DNA vaccine expressing BCSP31, SOD and L7/L12 , B. abortus DNA vaccine pcDNA-SOD , B. abortus DNA vaccine pcDNA3-SOD encoding Cu-Zn SOD , Recombinant B. abortus RB51SOD
  • Localization(Probability): Periplasmic
    (Prob.=1)
  • Adhesin Probability: 0.548
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
25. SurA
  • Gene Name : SurA
  • Sequence Strain (Species/Organism) : Brucella abortus 2308
  • VO ID : VO_0010971
  • NCBI Gene ID : 3787419
  • NCBI Protein GI : 489056605
  • Locus Tag : BAB_RS19295
  • Genbank Accession : JMRZ01000012
  • Protein Accession : WP_002966738
  • Taxonomy ID : 359391
  • Chromosome No : I
  • Gene Starting Position : 688353
  • Gene Ending Position : 689309
  • Gene Strand (Orientation) : -
  • Protein Name : molecular chaperone SurA
  • Protein pI : 10.47
  • Protein Weight : 32511.89
  • Protein Length : 318
  • DNA Sequence : Show Sequence
    >NC_007618.1:688353-689309 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
    GTCAACGATTGACGATGGTGGCCTTTTCGCGCAGTTCCTGCACGTATTTCTTGCTGAGTTCCTCAGCCTT
    CTTTTCCTGCCCCGCAGGGGAATCCGCGCCTTCCATGGAGAAGACAAGCTGTGCAACGCGGTCATCCGAC
    ACCTGACGGGTGGAGCATACGGCCAGGAATTCAACACCCTTTTCCGTATCGTGCGGCTTGGTCGTCCGGT
    TGACGCCAGCGGCCTTCACATCCTTGGACCATTCGCCGGGCAATTGCGGCTCGATGATACGGCCAAGATC
    GCGGACGGTCACATCGAGAATGCCCTTGGCTTGCTGGCGCGTGCTGTCACAATTCTGGAAGCGCGCGCGC
    AACGCATTGGCTTCCTGACGGCGTTTTGCCAGAAGAGCGGGCGAACGCTTGGAGGCGGGGACCACGAAAA
    TCACCTGCTGGAGATGATATTCAGTTGCAACGGGCTTCTTTCCGCCGTTCTTCAGCATACGCTGCACGGC
    TTCCTGCTCACTGACCATGCCGGTCGCGCGGAAGCGGGCGCTGACAAGGCGGCCCCAGCCCATCTGGACC
    ATGATATATTTCTTGAAATGTTCCGGCGTGACGCCCGACTGGTTCATAACCTGATTGAGCTGCGCCAGCG
    TCATCTTGTTGCGGCTTGCAAACCCGGCATAGGCGTCATCCACTTCCTTATCGGAAATATTGATGCCACG
    CGATTTCATCTCGATGCGCTTGAGCATTTCTTCGGTAAGCTCGTTGCGCGCAAGCTGGTTGAGATTGCCG
    CTTTTACGCTGAAGCTTGAGGAAGGCCATACGGTGCTTGATGTCGCTATTGGTAATAGCATTGCCGGACA
    CGATGACTTTGACCTCGGATTCTCCTGCGGCGAAAGCTGGAGCCGCAACCGTTCCAAGCGCCGTCAAGCA
    AACGGCAGCGCCTAGCATGGAGGCGATAAGAGGTCTTGCAAACATCA
    
    
  • Protein Sequence : Show Sequence
    >WP_002966738.1 MULTISPECIES: peptidylprolyl isomerase [Brucella]
    MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRKSGNLNQLA
    RNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSGVTPEHFKKYIMVQMGWGR
    LVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFVVPASKRSPALLAKRRQEANALRARFQNC
    DSTRQQAKGILDVTVRDLGRIIEPQLPGEWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQ
    LVFSMEGADSPAGQEKKAEELSKKYVQELREKATIVNR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Brucella SurA is a protective antigen (Delpino et al., 2007b).
  • COG: COG0760O, under O: Posttranslational modification, protein turnover, chaperones
  • Related Vaccine(s): Brucella recombinant SurA protein vaccine
  • Localization(Probability): Unknown
    (Prob.=0.49)
  • Adhesin Probability: 0.314
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
26. Tig
  • Gene Name : Tig
  • Sequence Strain (Species/Organism) : Brucella melitensis bv. 1 str. 16M
  • VO ID : VO_0010969
  • NCBI Gene ID : 1196780
  • NCBI Protein GI : 17987352
  • Locus Tag : BMEI1069
  • Genbank Accession : AE008917
  • Protein Accession : NP_539986
  • Taxonomy ID : 224914
  • Chromosome No : I
  • Gene Starting Position : 1112655
  • Gene Ending Position : 1114112
  • Gene Strand (Orientation) : -
  • Protein Name : trigger factor
  • Protein pI : 4.64
  • Protein Weight : 50680.09
  • Protein Length : 485
  • Protein Note : Tig; RopA; peptidyl-prolyl cis/trans isomerase; promotes folding of newly synthesized proteins; binds ribosomal 50S subunit; forms a homodimer
  • Protein Annotation : Also called Tf: Trigger Factor.
  • DNA Sequence : Show Sequence
    >NC_003317.1:1112655-1114112 Brucella melitensis bv. 1 str. 16M chromosome I, complete sequence
    ATCAAGCCTCTTCGGACTTGCCTTCTTCGGCCTTCTTCTTCGGCGCAGCCTTCTTCTTCGCAGCCGCCTT
    CTTGGCAGGCTTTGCTTCCGAAGCTGCATCTTCGTCTTCAGCCGTCAGCTCTTCCTTCGAGACCTTCTTG
    TCGGTCACATTGATGTTGGCCAGCAGATGATCGACGACCTTTTCTTCAAAGATCGGCGCGCGCAGATTGG
    CGACGGCATCCGGCGTACGGCGCAGGAAGTCGTAGATTTCCTTTTCCTGACCCGGATAGCGGCGAACCTG
    ATCGTAAACAGCGCGCTGCAGTTCTTCTTCGGTCACTTCCACGCCTGCCTTCTCGCCGATTTCGGAGAGA
    ACGAGGCCAAGACGAACGCGGCGTTCTGCAAGCTTGCGATATTCTTCGCGAGCAGCTTCTTCCGTCGTTT
    CCTCGTCTTCAAAGGTGCGGCCAGCCTGCTGCAGGTCGAAGTTGATCTGCTGCCAGATGTTGTTGAACTC
    GGCGTCAACCAGCTTCTGCGGGGTTTCAAACTGATAATCACCATCAAGGGCGTCGAGAATCTGACGCTTC
    ACTTTCTGGCGGGTGATCTGGCCGTACTGGCTTTCGATCTGTTCGCGCACAACCTGACGCAGACGCTCAA
    GCGACTCAATGCCGAGCTTCTTTGCGGTTTCGTCATCGAGAACGAGTTCGTTCGGCTTGGCAACTTCCTT
    CACCTTGATGTCGAAGGTTGCTTCCTTGCCAGCCAGATGCGCAGCGCCGTATTCAGCCGGGAACGTTACG
    GTGATGACCTTCTCGTCGCCAGCCTTCAAGCCAATGAGCTGTTCTTCAAAGCCCGGAATGAACTGGCCGG
    AACCGAGAACGAGCTGTGCGTCATTGTCTGCACCGCCTTCAAACGGCTCGCCGTCGAGCTTGCCCAGATA
    GTCGATCGTGACGCGATCTTCGTTTTCGGCCTTGCCCTTCTTGGTTTCAAAGGTGCGGGTCGACGACGCA
    ATGCGCTTGACCTGTTCATCGACTTCCTCATCGGAAATGTCGACGACTTCACGGGTCACGGCGATCTTGG
    AGAAGTCCTTGACCTCGATTGCCGGCAGCACTTCATAGTTCAGCGAGAAAACGAAATCGGCCTTGCCGTC
    GAGAACCTTCTCGGCTTCTTTTTCGTCTTCCGACATGATGACTTCAGGCTGGGTCGCCGACTTTTCGTTG
    CGTTCGGCAAGGATGGAACGCGACGAATCGTTGAGGATTTCGTTGACGATCTCGGCCATGAAGGACTTGC
    CGTACATCTTGCGCAGGTGAGCCGTCGGCACCTTGCCCGGACGGAAGCCGTTGATGCGGGCGCGGCCGCG
    CGCGGTTTCGAGCCGCTCAGCGAGCTTGGCTTCAAGATCCCCGGCCGGAACCACGACTTTGATCTCGCGC
    TTCAGCCCTTCATTGAGCGTTTCGGTAACCTGCATGTTCAAACCTTCACTTCTTGTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_539986.1 trigger factor [Brucella melitensis bv. 1 str. 16M]
    MTRSEGLNMQVTETLNEGLKREIKVVVPAGDLEAKLAERLETARGRARINGFRPGKVPTAHLRKMYGKSF
    MAEIVNEILNDSSRSILAERNEKSATQPEVIMSEDEKEAEKVLDGKADFVFSLNYEVLPAIEVKDFSKIA
    VTREVVDISDEEVDEQVKRIASSTRTFETKKGKAENEDRVTIDYLGKLDGEPFEGGADNDAQLVLGSGQF
    IPGFEEQLIGLKAGDEKVITVTFPAEYGAAHLAGKEATFDIKVKEVAKPNELVLDDETAKKLGIESLERL
    RQVVREQIESQYGQITRQKVKRQILDALDGDYQFETPQKLVDAEFNNIWQQINFDLQQAGRTFEDEETTE
    EAAREEYRKLAERRVRLGLVLSEIGEKAGVEVTEEELQRAVYDQVRRYPGQEKEIYDFLRRTPDAVANLR
    APIFEEKVVDHLLANINVTDKKVSKEELTAEDEDAASEAKPAKKAAAKKKAAPKKKAEEGKSEEA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : protective antigen (Yang et al., 2007)
  • COG: COG0544O, under O: Posttranslational modification, protein turnover, chaperones
  • Related Vaccine(s): B. melitensis bp26 and TF Nasal Vaccine
  • Localization(Probability): Cytoplasmic
    (Prob.=0.896)
  • Adhesin Probability: 0.079
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
II. References
1. Al-Mariri et al., 2001: Al-Mariri A, Tibor A, Mertens P, De Bolle X, Michel P, Godefroid J, Walravens K, Letesson JJ. Protection of BALB/c mice against Brucella abortus 544 challenge by vaccination with bacterioferritin or P39 recombinant proteins with CpG oligodeoxynucleotides as adjuvant. Infection and immunity. 2001 Aug; 69(8); 4816-22. [PubMed: 11447155 ].
2. Al-Mariri et al., 2002: Al-Mariri A, Tibor A, Lestrate P, Mertens P, De Bolle X, Letesson JJ. Yersinia enterocolitica as a vehicle for a naked DNA vaccine encoding Brucella abortus bacterioferritin or P39 antigen. Infection and immunity. 2002; 70(4); 1915-1923. [PubMed: 11895955].
3. Commander et al., 2007: Commander NJ, Spencer SA, Wren BW, MacMillan AP. The identification of two protective DNA vaccines from a panel of five plasmid constructs encoding Brucella melitensis 16M genes. Vaccine. 2007; 25(1); 43-54. [PubMed: 17049676].
4. Delpino et al., 2007b: Delpino MV, Estein SM, Fossati CA, Baldi PC, Cassataro J. Vaccination with Brucella recombinant DnaK and SurA proteins induces protection against Brucella abortus infection in BALB/c mice. Vaccine. 2007; 25(37-38); 6721-6729. [PubMed: 17686554].
5. Edmonds et al., 2002: Edmonds MD, Cloeckaert A, Elzer PH. Brucella species lacking the major outer membrane protein Omp25 are attenuated in mice and protect against Brucella melitensis and Brucella ovis. Veterinary microbiology. 2002; 88(3); 205-221. [PubMed: 12151196].
6. Fu et al., 2012: Fu S, Xu J, Li X, Xie Y, Qiu Y, Du X, Yu S, Bai Y, Chen Y, Wang T, Wang Z, Yu Y, Peng G, Huang K, Huang L, Wang Y, Chen Z. Immunization of Mice with Recombinant Protein CobB or AsnC Confers Protection against Brucella abortus Infection. PloS one. 2012; 7(2); e29552. [PubMed: 22383953].
7. Gee et al., 2005: Gee JM, Valderas MW, Kovach ME, Grippe VK, Robertson GT, Ng WL, Richardson JM, Winkler ME, Roop RM 2nd. The Brucella abortus Cu,Zn superoxide dismutase is required for optimal resistance to oxidative killing by murine macrophages and wild-type virulence in experimentally infected mice. Infection and immunity. 2005 May; 73(5); 2873-80. [PubMed: 15845493].
8. Goldbaum et al., 1999: Goldbaum FA, Velikovsky CA, Baldi PC, Mortl S, Bacher A, Fossati CA. The 18-kDa cytoplasmic protein of Brucella species --an antigen useful for diagnosis--is a lumazine synthase. Journal of medical microbiology. 1999 Sep; 48(9); 833-9. [PubMed: 10482294 ].
9. He et al., 2002: He Y, Vemulapalli R, Schurig GG. Recombinant Ochrobactrum anthropi expressing Brucella abortus Cu,Zn superoxide dismutase protects mice against B. abortus infection only after switching of immune responses to Th1 type. Infection and immunity. 2002 May; 70(5); 2535-43. [PubMed: 11953393].
10. Hemmen et al., 1995: Hemmen F, Weynants V, Scarcez T, Letesson JJ, Saman E. Cloning and sequence analysis of a newly identified Brucella abortus gene and serological evaluation of the 17-kilodalton antigen that it encodes. Clinical and diagnostic laboratory immunology. 1995 May; 2(3); 263-7. [PubMed: 7664168 ].
11. Luo et al., 2006b: Luo D, Ni B, Li P, Shi W, Zhang S, Han Y, Mao L, He Y, Wu Y, Wang X. Protective immunity elicited by a divalent DNA vaccine encoding both the L7/L12 and Omp16 genes of Brucella abortus in BALB/c mice. Infection and immunity. 2006; 74(5); 2734-2741. [PubMed: 16622210].
12. Onate et al., 2003: Onate AA, Cespedes S, Cabrera A, Rivers R, Gonzalez A, Munoz C, Folch H, Andrews E. A DNA vaccine encoding Cu,Zn superoxide dismutase of Brucella abortus induces protective immunity in BALB/c mice. Infection and immunity. 2003 Sep; 71(9); 4857-61. [PubMed: 12933826].
13. Pasquevich et al., 2009: Pasquevich KA, Estein SM, GarcĂ­a Samartino C, Zwerdling A, Coria LM, Barrionuevo P, Fossati CA, Giambartolomei GH, Cassataro J. Immunization with recombinant Brucella species outer membrane protein Omp16 or Omp19 in adjuvant induces specific CD4+ and CD8+ T cells as well as systemic and oral protection against Brucella abortus infection. Infection and immunity. 2009; 77(1); 436-445. [PubMed: 18981242].
14. Rosinha et al., 2002b: Rosinha GM, Myioshi A, Azevedo V, Splitter GA, Oliveira SC. Molecular and immunological characterisation of recombinant Brucella abortus glyceraldehyde-3-phosphate-dehydrogenase, a T- and B-cell reactive protein that induces partial protection when co-administered with an interleukin-12-expressing plasmid in a DNA vaccine formulation. Journal of medical microbiology. 2002; 51(8); 661-671. [PubMed: 12171297].
15. Suryanarayana et al., 2016: Suryanarayana N, Verma M, Thavachelvam K, Saxena N, Mankere B, Tuteja U, Hmuaka V. Generation of a novel chimeric PALFn antigen of Bacillus anthracis and its immunological characterization in mouse model. Applied microbiology and biotechnology. 2016; 100(19); 8439-8451. [PubMed: 27364624].
16. Velikovsky et al., 2002: Velikovsky CA, Cassataro J, Giambartolomei GH, Goldbaum FA, Estein S, Bowden RA, Bruno L, Fossati CA, Spitz M. A DNA vaccine encoding lumazine synthase from Brucella abortus induces protective immunity in BALB/c mice. Infection and immunity. 2002 May; 70(5); 2507-11. [PubMed: 11953389 ].
17. Vemulapalli et al., 2000: Vemulapalli R, He Y, Cravero S, Sriranganathan N, Boyle SM, Schurig GG. Overexpression of protective antigen as a novel approach to enhance vaccine efficacy of Brucella abortus strain RB51. Infection and immunity. 2000 Jun; 68(6); 3286-9. [PubMed: 10816475].
18. Yang et al., 2007: Yang X, Walters N, Robison A, Trunkle T, Pascual DW. Nasal immunization with recombinant Brucella melitensis bp26 and trigger factor with cholera toxin reduces B. melitensis colonization. Vaccine. 2007; 25(12); 2261-2268. [PubMed: 17239499].