VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

manA

Gene Name manA
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
NCBI Protein GI 260563601
Locus Tag BAB1_0562
Other Database IDs CDD:32765
CDD:29324
Taxonomy ID 224914
Chromosome No I
Gene Starting Position 550431
Gene Ending Position 551708
Gene Strand (Orientation) ?
Protein Name ManA family protein
Protein Length 390
Protein Note N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism]
DNA Sequence
>gi|82698932:550431-551708 Brucella melitensis biovar Abortus 2308 chromosome chromosome I, complete sequence
AATGAATGATGTGATACGTAAACTTCAGGTGGAAGTGGAGCGCTTATCGTCGTGGCTCCACAACGACGCT
TTGCCTCTTTGGTTGTCAGCCGGTGTGGATGCGCCGAATAGCGGTTTCTTTGAACGTATTGGACAGGACG
GCGTCGCAACGGATGCGGATAATCGTCGTTCTCGCGTGCATCCGAGACAGATCTACTGTTTCGCCAAGGC
TGGCGCCATGGGCTGGCAAGGCGAATGGAAGCAGACGGTTGAAGCCGGAATAGAATATTATGATCGCGTC
TATCGGCGAGAAGATGGTTTCTATGGCAGTCTTGCCGGTCAAAGTGGCAAGATGATTGATCACACGTTTG
ATCTCTACAATCAGGCTTTTTCCGTTTTTGCGGCCGCCCAGATCGCGGTTTCCATACCGGATCGGTTTGA
TGAAATGCGTCAGCGAGCGCTTGGTTTGATGAATACGCTCGTGGCAGATTATCACCACCCTCTCGGTGGA
TTTGAGGAAGCCAACCCGCCAAAGCTTCCCTTGTGTTCAAATCCGCACATGCATTTGTTTGAAGCAATGC
TTGCCTGGGAGACTGTCGATCCAGAAACCCAGTTCTGGTCCACATATGCCGATGAGATCGCAAATCTTGC
CTTAACGAAATTCATCGATGGCAAGACCGGTGCGTTGCGTGAATTCTTCGATCACGATTGGAAACCTTAT
CCGGGTGACAAGGGGAGGGTGGTCGAACCAGGACATCAATTCGAATGGTCCTGGCTGATGGGCCAATGGG
CGGACCGACGGCAGAATGGCGATGGCATGATGGCCGCCAAGCGTCTATTCCAGATTGCAGTGGATCGTGG
TGTATGCGAGCAGCGCAAAGTTGCCATCATGAGCTTGTATGATGATTTTTCGGTTCACGACAGTCTGGCC
CGTCTCTGGCCGCAAACTGAATGGATAAAGTCGGCTCTGTTATTTGCTTCTTTGAGCAAGGACGAAGAGC
GAGTTTACTATCTGCAATCCGCATTGCGTGCCATTGACGCCCTACGGCCATTTCTTGAAACGCCAATCAA
AGGCTTATGGTACGACAAGTGGCCGGAAGGTGGTACGCTTATCGATGAGCCCGCGCCGGCATCGACCTTT
TATCATATTCTCTGTGCCTGTTATGAAGCAGAGAAAACAATATCAGAGCTTTATGTTGTGGTGTCGAATT
TTTGGTTGTCGCCGCTGATGATGACGATCAGATGTGCCGATGATGCCGCATCTGTATTGGAGAAACATGC
GAGTTCTTCATTTTTTTA
Protein Sequence
>gi|260563601|ref|ZP_05834087.1| ManA family protein [Brucella melitensis bv. 1 str. 16M]
MNDVIRKLQVEVERLSSWLHNDALPLWLSAGVDAPNSGFFERIGQDGVATDADNRRSRVHPRQIYCFAKA
GAMGWQGEWKQTVEAGIEYYDRVYRREDGFYGSLAGQSGKMIDHTFDLYNQAFSVFAAAQIAVSIPDRFD
EMRQRALGLMNTLVADYHHPLGGFEEANPPKLPLCSNPHMHLFEAMLAWETVDPETQFWSTYADEIANLA
LTKFIDGKTGALREFFDHDWKPYPGDKGRVVEPGHQFEWSWLMGQWADRRQNGDGMMAAKRLFQIAVDRG
VCEQRKVAIMSLYDDFSVHDSLARLWPQTEWIKSALLFASLSKDEERVYYLQSALRAIDALRPFLETPIK
GLWYDKWPEGGTLIDEPAPASTFYHILCACYEAEKTISEL
Molecule Role Virmugen
Molecule Role Annotation Unmarked rough B. abortus and B. melitensis deletion mutants of manBA (including manA and manB) were attenuated. These mutants provided protection against virulent Brucella challenge in mice (Kahl-McDonagh and Ficht, 2006).
Related Vaccines(s) B. abortus and B. melitensis mutants with unmarked deletion of asp24, virB2, or manBA
References