VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

clpP from S. typhimurium str. LT2

Gene Name clpP from S. typhimurium str. LT2
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI Gene ID 1251968
NCBI Protein GI 16763829
Locus Tag STM0448
Genbank Accession AE006468
Protein Accession NP_459444
Taxonomy ID 700720
Gene Starting Position 503209
Gene Ending Position 503832
Gene Strand (Orientation) +
Protein Name ATP-dependent Clp protease proteolytic subunit
Protein pI 5.88
Protein Weight 22084.77
Protein Length 207
Protein Note hydrolyzes proteins to small peptides; with the ATPase subunits ClpA or ClpX, ClpP degrades specific substrates
DNA Sequence
>gi|16763390:503209-503832 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
AATGTCATACAGCGGAGAACGAGATAATTTGGCCCCTCATATGGCGCTGGTGCCGATGGTCATTGAACAG
ACCTCACGCGGTGAGCGCTCTTTTGATATCTATTCTCGTCTACTTAAGGAACGCGTCATATTTCTGACCG
GCCAGGTCGAAGACCATATGGCTAACCTGATCGTGGCGCAGATGCTGTTCCTGGAAGCGGAAAACCCGGA
AAAAGATATCTATCTGTACATTAATTCTCCTGGCGGCGTAATTACTGCGGGGATGTCCATCTATGACACC
ATGCAGTTTATTAAGCCAGACGTCAGCACCATTTGTATGGGACAGGCGGCCTCTATGGGGGCGTTTCTGC
TGACTGCCGGGGCGAAAGGCAAACGTTTCTGCTTGCCGAACTCTCGCGTCATGATCCACCAGCCGCTGGG
CGGCTACCAGGGCCAGGCGACGGATATTGAAATTCACGCCCGCGAAATTTTGAAAGTAAAAGGGCGCATG
AATGAACTTATGGCGCATCATACGGGTCAATCTCTTGAGCAGATTGAACGTGATACTGAGCGCGATCGCT
TCCTCTCCGCGCCTGAAGCGGTAGAGTACGGTTTGGTTGACTCAATTTTGACCCATCGTAATTG
Protein Sequence
>gi|16763829|ref|NP_459444.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPE
KDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLG
GYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN
Molecule Role Virmugen
Molecule Role Annotation A mutation in clpP (CS2007) causes hyperflagellation. These hyperflagellated bacteria are attenuated in mice, and an LD50 for CS2007 could not be determined because mice did not die after inoculation with the highest dose. CS2007 also elicited protection in mice from challenge with wild type S. typhimurium (Matsui et al., 2003).
Related Vaccines(s) Salmonella Typhimurium clpP mutant vaccine , Salmonella Typhimurium guaBA/clpP mutant vaccine , Salmonella Typhimurium guaBA/clpP/fliD mutant vaccine
References