VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

RD1

Gene Name RD1
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 885777
NCBI Protein GI 15610750
Locus Tag Rv3614c
Genbank Accession BX842583
Protein Accession NP_218131
Taxonomy ID 83332
Gene Starting Position 4054141
Gene Ending Position 4054695
Gene Strand (Orientation) -
Protein Name hypothetical protein
Protein pI 3.73
Protein Weight 18643.7
Protein Length 184
Protein Note Rv3614c, (MTCY07H7B.08), len: 184 aa. Conserved hypothetical protein, equivalent to Q49730|ML0407|B1620_C3_264|MLCL383.03 HYPOTHETICAL 24.2 KDA PROTEIN from Mycobacterium leprae (216 aa) FASTA scores: opt: 899, E(): 1.7e-51, (71.3% identity in 188 aa overlap); and similar to two hypothetical proteins from Mycobacterium leprae: Q9CDD6|ML0056 (169 aa), FASTA scores: opt: 285, E(): 1.2e-11, (38.35% identity in 172 aa overlap); and O33090|MLCB628.19c (338 aa), FASTA scores: opt: 289, E(): 1.2e-11, (38.95% identity in 172 aa overlap). Also highly similar to O69732|Rv3867|MTV027.02 HYPOTHETICAL 19.9 KDA PROTEIN from Mycobacterium tuberculosis (183 aa), FASTA scores: opt: 563, E(): 1e-29, (54.9% identity in 173 aa overlap).
DNA Sequence
>gi|57116681:4054141-4054695 Mycobacterium tuberculosis H37Rv, complete genome
CTCACCATGGATCGCTCTCGTCGTCTGGTGCTGGACAATCGTCGCTGTAGCGCGTCGCGAACACCTCAGC
TTCTGCTGCCGCGGCTTCTTCCGGCGATGGTAACCCCCAGGTTTCGCCCACGGTCTTACGTAGCAGTGCG
ACGCGGTGTTCATCTGCATCGACCTGTTGACTCATCCTGTCAAGGATGAAGGCGTACTGGGCCGACTGCG
CCTTCTGCCGCGCCAGGTCGGCAATCACCAGGATCTCAGAAGCGAGCTGCGACTCACTCATCCAGGCCAC
CCTGGCCGACAGCTCGACATGGTCAATCCGGCCGTCCATCAGCGTCGATACCGACACCGTGCGTGGGGGA
TTCGTCACGGTAAAAAGCGCGATCTCTTGTTCGGTGTCCGTCTCCGCCTGACCGTGGGCATTGTCCAGGT
CGGGTCCGGTGTCCGGGGTCGCCGCCGACCCGACGCCAATAATCGGATCCGCAGTCCAGCCCTCCGCGCC
GTCGGCACCCCAGAGATCCACGGCGTCGAAATCGTTGCTGTCAAAGTCATTTCCGGGCAAGTCCA
Protein Sequence
>gi|15610750|ref|NP_218131.1| hypothetical protein Rv3614c [Mycobacterium tuberculosis H37Rv]
MDLPGNDFDSNDFDAVDLWGADGAEGWTADPIIGVGSAATPDTGPDLDNAHGQAETDTEQEIALFTVTNP
PRTVSVSTLMDGRIDHVELSARVAWMSESQLASEILVIADLARQKAQSAQYAFILDRMSQQVDADEHRVA
LLRKTVGETWGLPSPEEAAAAEAEVFATRYSDDCPAPDDESDPW
Molecule Role Virmugen
Molecule Role Annotation RD1 and panCD mutants in Mycobacterium tuberculosis were attenuated and provided protection in CD4-deficient mice against an aerosol challenge with virulent M. tuberculosis (Sambandamurthy et al., 2006).
Related Vaccines(s) Mycobacterium tuberculosis RD1/panCD mutant vaccine
References