VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

atpA

Gene Name atpA
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhimurium SL1344
NCBI Protein GI 301160399
Locus Tag STM3867
Genbank Accession AE006468
Protein Accession NP_462766
Other Database IDs CDD:181753
CDD:199133
CDD:29998
CDD:144044
UniProtKB/TrEMBL: E1WDU3
Taxonomy ID 216597
Gene Starting Position 4076433
Gene Ending Position 4077974
Gene Strand (Orientation) -
Protein Name ATP synthase alpha subunit
Protein pI 5.78
Protein Weight 51045.02
Protein Length 513
Protein Note F0F1 ATP synthase subunit alpha; Validated
DNA Sequence
>gi|16763390:4076433-4077974 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
GTTACCAGGACTGGGTTGCTTTGAAGGAATCGAGGATGCCTTTCAGCTTGCCTTCGATTTCGTCGTTATA
GCCACCGGACTGGTTGATCTCTTGCATCAGCGGAGCGTGATCACGGTCGACGTAAGCCAGCAGTGCGGCT
TCGAAGCTACCGATTTTCGCCAGTTCGACATCCGCCAGATAACCACGTTCTGCTGCGAACAGAACCAGAG
ACTGCTGCGCGACGGACATCGGCGCATACTGTTTCTGTTTCAGCAGTTCGGTCACTTTCTGACCGTGGTC
AAGCTGTTTACGGGTGGCATCGTCAAGGTCGGATGCAAACTGAGAGAACGCCGCCAGTTCACGATACTGC
GCCAGCGCGGTACGAATACCACCGGACAGTTTTTTCATGATCTTGGTCTGGGCTGCGCCACCTACACGGG
ATACCGAGATACCCGGGTTAACCGCAGGACGGATACCGGCGTTAAACAGGTTAGATTCCAGGAAGATCTG
ACCATCGGTAATGGAAATTACGTTGGTCGGAACGAACGCGGAAACGTCACCTGCCTGCGTTTCGATAATC
GGCAGCGCAGTCAGTGAACCGGTTTTCCCTTTCACTTCACCTTTAGTGAAGGCTTCGACGTAGTCGGCGT
TAACACGCGCAGCACGCTCCAGCAGACGAGAGTGGAGGTAGAATACGTCGCCCGGGAATGCTTCACGTCC
TGGCGGACGACGGAGCAGCAGGGAGATCTGACGGTAAGCAACAGCCTGTTTAGACAGGTCATCGTAAATG
ATCAGCGCATCTTCGCCGCGGTCACGGAAGTATTCGCCCATTGCGCAACCGGCATACGGCGCCAGATATT
GCAGCGCAGCGGATTCGGACGCGGTCGCCACCACAACAATGGTGTTAGCCAGCGCGCCGTGCTCTTCCAG
TTTACGCACCACGTTAGAGATGGTGGACGCTTTCTGGCCGATAGCGACATAGATACATTTGATGCCGGAG
TCGCGCTGGTTGATGATGGCGTCGATAGCCAGCGCGGTTTTACCGGTCTGACGGTCACCGATGATCAGTT
CACGCTGACCACGACCGATTGGGATCATGGAGTCAACGGCTTTATAGCCGGTCTGCACCGGCTGATCGAC
AGACTGACGATCGATAACGCCCGGCGCAATCGCTTCAACGGCAGAGAAGCCGTCATTATCAACCGGACCT
TTACCGTCAATTGGCGCACCCAGGGTGTTTACCACACGTCCCAGCAGGCCGCGGCCAACCGGAACTTCCA
GGATACGACCCGTACATTTAACCTTCATGCCTTCGGCAAGGTCAGCGTATGGACCCATGACTACCGCACC
CACGGAGTCGCGCTCCAGGTTCAGTGCGATAGCGTAACGGTTACCCGGCAGGGAGATCATTTCACCCTGC
ATACAATCGGCCAGGCCGTGAATGCGGATAACACCGTCACTGACAGAAACAATAGTACCTTCGTTGTGAG
CTTCGCTCACCACATTGAACTGAGCAATGCGCTGCTTGATCAGTTCGCTGATTTCGGTGGAATTCAGTTG
CA
Protein Sequence
>gi|301160399|emb|CBW19925.1| ATP synthase alpha subunit [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344]
MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRYAIALNLERDS
VGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLLGRVVNTLGAPIDGKGPVDNDGFSAVEAIAPGVIDRQ
SVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAIDAIINQRDSGIKCIYVAIGQKASTISNVVR
KLEEHGALANTIVVVATASESAALQYLAPYAGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRP
PGREAFPGDVFYLHSRLLERAARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITD
GQIFLESNLFNAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ
LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHAPLMQEINQSG
GYNDEIEGKLKGILDSFKATQSW
Molecule Role Virmugen
Molecule Role Annotation An atpA mutant is attenuated in mice and induces significant protection from challenge with wild type S. typhimurium (Chaudhuri et al., 2009).
Related Vaccines(s) Salmonella Typhimurium atpA mutant vaccine
References