VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

poxA

Gene Name poxA
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI Gene ID 1255870
NCBI Protein GI 16767593
Locus Tag STM4344
Genbank Accession AE006468
Protein Accession NP_463208
3D structure: PDB ID 3G1Z
Taxonomy ID 700720
Gene Starting Position 4586094
Gene Ending Position 4587071
Gene Strand (Orientation) +
Protein Name lysyl-tRNA synthetase
Protein pI 4.92
Protein Weight 35366.49
Protein Length 325
Protein Note lysine--tRNA ligase beta chain; poxA; class II aminoacyl tRNA synthetase; catalyzes a two-step reaction; first charging a lysine molecule by linking the carboxyl group to the alpha-phosphate of ATP; second by transfer of the aminoacyl-adenylate to its tRNA
DNA Sequence
>gi|16763390:4586094-4587071 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
CATGAGCGAAACGGCAACCTGGCAGCCGAGCGCGTCCATCCCCAATTTATTAAAACGTGCGGCGATTATG
GCGGAAATCCGTCGTTTCTTTGCCGATCGTGGAGTGCTTGAGGTTGAGACGCCCTGCATGAGTCAGGCGA
CGGTCACAGACATTCATCTGTTCCCGTTCGAAACGCGTTTCGTCGGACCTGGCCATTCCCAGGGGATCAA
CCTCTATTTAATGACCAGTCCGGAATACCATATGAAACGCCTGCTGGCGGCAGGGTGCGGCCCGGTTTTC
CAGCTATGCCGCAGTTTCCGTAATGAAGAGATGGGACGACATCATAATCCGGAATTCACTATGCTGGAGT
GGTATCGCCCGCATTACGATATGTACCGCCTGATGAATGAAGTGGATGATTTGCTTCAGCAAGTGCTGGA
TTGTCAACCTGCGGAAAGTCTCTCCTATCAACAGGCGTTTCAGCGCCATCTGGAGATTGACCCGTTATCA
GCAGATAAAACGCAACTGCGTGAGGCGGCGGCAAAGCTTGATTTAAGCAATATCGCCGATACGGAAGAAG
ACCGTGATACGTTGCTGCAACTGTTGTTCACGATGGGGGTTGAGCCGCATATAGGTAAAGAAAAGCCGAC
CTTTATTTATCACTTTCCGGCAAGTCAGGCATCGCTGGCACAAATCAGTACCGAGGATCATCGCGTCGCC
GAGCGCTTTGAGGTGTACTACAAAGGTATTGAGCTGGCGAATGGTTTCCACGAACTGACGGACGCACGTG
AGCAACAACAGCGCTTTGAACAGGACAATCGTAAGCGCGCCGCTCGCGGTCTGCCGCAGCAGCCGATTGA
CCAAAATCTACTGGATGCGCTGGCCGCCGGTCTACCGGATTGTTCCGGCGTGGCGCTGGGTGTTGATCGT
CTGGTGATGCTGGCGCTGGGAGCAGAAAGCCTGGCGGACGTGATTGCTTTTACGGTCGATCGGGCGTA
Protein Sequence
>gi|16767593|ref|NP_463208.1| lysyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGIN
LYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLD
CQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPT
FIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPID
QNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA
Molecule Role Virmugen
Molecule Role Annotation A poxA mutant is attenuated in mice and induces significant protection from challenge with wild type S. typhimurium (Kaniga et al., 1998).
Related Vaccines(s) Salmonella Typhimurium poxA mutant vaccine
References