VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ICP0

Gene Name ICP0
Sequence Strain (Species/Organism) Human herpesvirus 2
NCBI Gene ID 1487289
NCBI Protein GI 109676722
Locus Tag HHV2gp61
Genbank Accession Z86099
Protein Accession NP_044528
Taxonomy ID 10310
Gene Starting Position 121626
Gene Ending Position 124946
Gene Strand (Orientation) -
Protein Name ubiquitin E3 ligase ICP0
Protein pI 8.18
Protein Weight 77292.34
Protein Length 824
DNA Sequence
>gi|9629267:121626-124946 Human herpesvirus 2, complete genome
CTTTATTGTAAAATTTTTATAAATATAAAGTTTTTTTTTTCCTCAAGTTTTCAACAAGGCCAGAAAGTCC
ATAACAAAATGCTGGTGTGTGTTGCTGTTCGGGGCCGTGTCCGTCCCCCCCCCCCACTCCCACCCCCACT
TCCTGTCTCCTCCCCGTCTTTCCCCCCCCCCACCTCCCCCTGCCCCCGAGGCGCCTCGGCCGGTGGTCCG
GTGGGGGGCGGCTTCCTTCGGGCAGCAAGCCGAGTGTTAGCTCCCCCTACTCCCCGTGGCCCGCGGGGGC
GTCGCCGGCCGGCGCGGGCGCGCCCTGCTCCCGAGACCACGGGTGGCGCGACCGGAGGCCGTGGAAGTCC
AGCGCGCCCACCAGGGTGCCCTGGTCAAAGAGCATGTTGCCCACCGGGGTCATCCAGAGGCTGTTCCACT
CCGACGCGGGGGGCGTCGGGTAGTCGGGGGGCCTCACGCAGTTGCGCGCGTGCTCGGGGAGCAGGGTGCG
GCGGCTCCACGCGGGGGCCGCGGCCCGCAGCAGGTCCGCCACGTTCCCCGTCTGGTCCACGAGGACCACG
TAGGCCCCTATGTGGCCCGTCTCCATGTCCAGGACGGGCAGGCAGTCCCCCGTGACCGTCTTGTTCACGT
AAGGCGCCAGGGCCACGACGCTCGAGACCCCCGCGATGGGCAGGTAGCGCGTGAGGCCGGGCGCCGGGTC
GCGGGCCCCGGGCTCGGGGCCGCCCTCCGCGTGGCGCGTCTTCCTGGCACACTTCCTCGGCCCCCGCGGC
GCAGCAGCGCGGGGGCCGAGGGAGGTTTCTCGTCTCTCCCCAGCGCCGGACGCGGACGCGACGCTCCCAC
CAGCCCCGCCCGCAGAGGAAGAGGCGGAGGAGGAGGAGGCGGAGGAGGAGGAGGCGGAGGAGGAGGAGGC
GGAGGAGGAGGAGGCGGAGGAGGAGGAGGCGGAGGAGGAGGAGGCGGAGGAGGAGGAGGCGGCGGCGACC
GCGGCCTGGGACGACGGAGACGCCGACGGGGGCGCGGCGCCCGCGGACGCCGGGGCGAGCGGCCCGTGGC
CGCGGTCGCCCGAGTCCGAGTCCGGGGCCCGGCGCGGCGCCGCCCTCTTGGCCCCCACCCCCTGGGGGGC
GAGGGGCGAGCGCGGGGCGGCGGAGGAAGAGGCGGAGGACGAGGCCGCGGGGCCCGAGTCCGACCCGCGC
CTCTTCCGGGGGCGGGCCGCCGCCCCCTCCGCGGCGTGGGGGGCGGCACCGGGGGTGTTGGTGCCGCGGG
GGACCCCGGGTCCTCCCTCCGCGCCCGGCCCTCCCGACCCGCGCGCGTCGGTCGCGCCTGCCCGGCCCAG
ACTCTGTGCTTGGGTGTCGGTCTGAGCCTGGGTCATGCGCGACCGGGGCGCGCGGTGCGCGTCCACCGGC
ACGGCGGGCGGCGCGGGCCCGGCCGCGTCCGCGCTCGCAGACACCACGGGGGCGGCGGCGGCGCGGGGCG
GACTCCGGACGCGCGGGGCGACGGCCGCGCGGGGGCGCGCGGCGCGCCCCGACGACTGTGGCAGACCTCC
CCCCCCGGGGCCCGAGGACACCTGTGCGGAGGAGGAGGAGACAAAGGAGAGCGGCCCGGGGCCCGCGGGG
CGGCGCGGAGACGGCGGGGGAGAGTCGCTGATGACTATGGGGGGCTCCTGGGCCGCGCGGGGCTGTCTCG
CGGGGGGCGTCCTGCCCTCCGCCGCCGCGGCGTCTTCGCCCACCCGCCGCGCCTGCGCGCGCCCCCCGCC
GGCCGCAGGGGGAAGAGAGGCCACTCTCGGCACGACGGCCGCGACGGCAGGGCCGCCCCCAGACCCAGAT
CCCACCCCCGCCCGCAACGGGGCGCCGCCGCTGCTGCTGCTCCGCGGGGCGCCAGGGGGCGCCGGTCGGG
TCGCGGCGGGCTGGGAGGTTCCGCGGGTCGCCCCCGCACCGCCGCCCCCGCGCCGGGGCGCTCTTCGGGG
GGCGGGCGGGACGTAGTCCACTGCAGAGGGAGACAGAGACGGGAGCCCCCGGTTAGTGCCCGACCCCCGC
CCGACCCCCGCCCGACCCCCGCCCGACCCCCGCCCGACCCCCGCCCGACCCCCGCCCGACCCCCGCCCGA
CCCCCGCCCGACCCCCGCCCGACCCCCGCCCGCCCCCCGCCCGACCCCCGCCCGCCCTCACCGTCGGCCA
GGTCATCGTCCTCGTCGTCCGTGCCGGGCCACGGGGGGGTGGGCGACAGGGCGCGGACCGTGTGTCCCCC
CAGCGACAGGGAGCGCGGGGCCGTCCGCGGGTTGCCCGTCCAGATAAAGTCCACGGCCGTGCCGGCCCGC
ACGGCCGCCTCGGCCTCCACGCGGGTCCGGGGGTCGTTCACTATCGGGATGGTGCTGAACGACCCGCTGG
CGGTCACGCCCACTATCAGGTACGCCACCGGGGTGTTGCACAGGGGACACGTGTTGCGCAACGGAATCCA
GGTCTTCATGCACGGGATGCAGAAGGGGTGCAGGCAGGGAAAACTCTGGCAGCGCAGGGGCGGGGCGATC
TCGTCCGTGCACACGGCACACACGTCGCCCCCCCCTCCCGCTTCCGCTTCCTCCTCACCCACGGGCCCAC
CCCCACAGGATCCCTGCGCGTCGGCGGGCGTGGGGCTGCCCTGGCGCTCGGCCGGGGGCCGGGCCGGGGG
CGTGGCCGCGTCCATCAGGCCCGCCTCGAACATCTCCGTGTCCGTGCTGCCCGCCTCGGAGGTGGAGTCG
CGGTGAAGGTCGTCGTCAGAGATTCCCACCTCGGTCTCCTCCTCCGAGTCGCTGCTGGCGAGCCACTGCA
TGTCGTTGAGCATCCCCCAGGCGTGCGGGGCGGCGGGCTGCTTGACAAAGCAACGGGGGGGATTTAGAGG
GCGCGGGGCGTGAGGCGGGACCCCCGCGCCGTGTCCCCCGTGTCCCTCCCTCACCCCGGCCCCCCGCCCG
CTGCTTTTTGTTCGGAAGGGGGGGAGAAAGGGGTCCGTAACCAAAGGTGGTCTGCGTCCTTTGGATTCCG
ACCCCTCGTCTCCCCCCCTGTCCCCCGCTCTCGGGCTCCTCCCTGCCTCCCTCGCCCCCCCAGAGGGTCG
GGGGGCGGCGCACGGCCCACGGGGGTCCCCCGACCGCTTAAGCGGGCCGGGGGTCGGCCCCGTCAAGCGT
CCCCGCCCCCGAGCCCACCGCCCGCGACCACCCCCAACCCGCAGCCGGGTGGTCCGGGGAAAAGGGGGGG
CCTGAGACCCGGGGGTCGCCCTCTCACCGTGCCGGGGGTCTGCCGCGGCGGCCGCTCGGGGCCGGGGTCC
GCCCGGGAGCTCGTGCCGGGCCGGGGTTCCA
Protein Sequence
>gi|109676722|ref|NP_044528.2| ubiquitin E3 ligase ICP0 [Human herpesvirus 2]
MEPRPGTSSRADPGPERPPRQTPGTPAAPHAWGMLNDMQWLASSDSEEETEVGISDDDLHRDSTSEAGST
DTEMFEAGLMDAATPPARPPAERQGSPTPADAQGSCGGGPVGEEEAEAGGGGDVCAVCTDEIAPPLRCQS
FPCLHPFCIPCMKTWIPLRNTCPLCNTPVAYLIVGVTASGSFSTIPIVNDPRTRVEAEAAVRAGTAVDFI
WTGNPRTAPRSLSLGGHTVRALSPTPPWPGTDDEDDDLADVDYVPPAPRRAPRRGGGGAGATRGTSQPAA
TRPAPPGAPRSSSSGGAPLRAGVGSGSGGGPAVAAVVPRVASLPPAAGGGRAQARRVGEDAAAAEGRTPP
ARQPRAAQEPPIVISDSPPPSPRRPAGPGPLSFVSSSSAQVSSGPGGGGLPQSSGRAARPRAAVAPRVRS
PPRAAAAPVVSASADAAGPAPPAVPVDAHRAPRSRMTQAQTDTQAQSLGRAGATDARGSGGPGAEGGPGV
PRGTNTPGAAPHAAEGAAARPRKRRGSDSGPAASSSASSSAAPRSPLAPQGVGAKRAAPRRAPDSDSGDR
GHGPLAPASAGAAPPSASPSSQAAVAAASSSSASSSSASSSSASSSSASSSSASSSSASSSSASSSAGGA
GGSVASASGAGERRETSLGPRAAAPRGPRKCARKTRHAEGGPEPGARDPAPGLTRYLPIAGVSSVVALAP
YVNKTVTGDCLPVLDMETGHIGAYVVLVDQTGNVADLLRAAAPAWSRRTLLPEHARNCVRPPDYPTPPAS
EWNSLWMTPVGNMLFDQGTLVGALDFHGLRSRHPWSREQGAPAPAGDAPAGHGE
Molecule Role Virmugen
Molecule Role Annotation A live-attenuated HSV-2 ICP0 virus provides significant protection against wild-type HSV-2 (MS strain) challenge in mice (Halford et al., 2011).
Related Vaccines(s) Herpes simplex virus 2 ICP0 mutant vaccine
References