VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

UL50

Gene Name UL50
Sequence Strain (Species/Organism) Suid herpesvirus 1
NCBI Gene ID 2952537
NCBI Protein GI 51557490
Locus Tag SuHV1_gp07
Genbank Accession BK001744
Protein Accession YP_068324
Taxonomy ID 10345
Gene Starting Position 8442
Gene Ending Position 9457
Gene Strand (Orientation) -
Protein Name deoxyuridine triphosphatase
Protein pI 9.02
Protein Weight 26335.82
Protein Length 268
Protein Note 3.6.1.23
DNA Sequence
>gi|51557483:8442-9457 Suid herpesvirus 1, complete genome
CTTTATTGAAAAATGAGAAGAGCGGGCCCCGCGTGTGTGCGCGCGCGGTCGCCACCGTCCGGGTCCGGCG
CGGGCCGCCGCGGCCTCACAGGCCCGTGGAGCCGAAGCCGCGGGCCCCGCGCGCGCTGCTCGGGGCGACA
AAGTCCCGCGCGAAGAGCCACGCGGGGCGGTGCTGCATCGGGGCGCGCGGGGTGGCGGGGAACGGGGACC
GTCCCGTGATCCAGCCCAGCGGCTCGCGCGTCAGCACCAGCTGGGCCACGCGCTGGCCCGACTCCAGGGT
CACCGGGTGCGCGCCGCGGTTCTGGATCCGGAAGCGGCACGGGCCGCTCTCCCAGGGCGTGGGGAAGACG
ACGATGCCGCGGAGGTTGAGGGACGAGCGCCCGAAGACGTAGGCCCAGTGGCGGCCGTCCGTGCGGTGCA
CCGGTAGCGTCACGGTCTCGGCGCCCCCGGGGGGCAGCACCAGCTCGCGCGGGCAGGGGATGTCGTATCC
GGCGTCCTCGTCGCGCTTCGGCGCAAAGACCTCGAAGAAGGGCACGTCCGTGGCGATGCCCGGCGCGAGG
CGCAGCGGCGTGCAATAAAATTGCGCCCGTGGGCGGCCCGGGGCTACAATCGCCTGCACCTCGCCGCGAA
AGCCCGCGTCCACGATCCCGTTGGTGGTGCGACCGCCCCCGCGCTGCGCGACGAGCATCGCGTATCCGGT
GGGCAGCGCCACCTTGAGGCCCAGGGGAACCTTATAAAATCCCTCCGGCCCCGGACTCCGGCACACCAGC
AGCCGCCCTCCGTCCACGGTCACGGGCTCGCTCGCACACACCAGGATGGTCTCCTCCGCCGGGCTCTCGC
TGACGCTCGTCGCCGCGCTCTGCGCGCTGGTGGCCCCCGCGCTCTCTTCCATCGTCTCCACCGAGGGGCC
GCTGCCGCTGCTGCGCGAGGAGTCGCGGATCAACTTCTGGAACGCCGCCTGCGCCGCCAGGGGAGTCCCG
GTGGATCAGCCCACGGCCGCCGCCGTGACATTTTAT
Protein Sequence
>gi|51557490|ref|YP_068324.1| deoxyuridine triphosphatase [Suid herpesvirus 1]
MEESAGATSAQSAATSVSESPAEETILVCASEPVTVDGGRLLVCRSPGPEGFYKVPLGLKVALPTGYAML
VAQRGGGRTTNGIVDAGFRGEVQAIVAPGRPRAQFYCTPLRLAPGIATDVPFFEVFAPKRDEDAGYDIPC
PRELVLPPGGAETVTLPVHRTDGRHWAYVFGRSSLNLRGIVVFPTPWESGPCRFRIQNRGAHPVTLESGQ
RVAQLVLTREPLGWITGRSPFPATPRAPMQHRPAWLFARDFVAPSSARGARGFGSTGL
Molecule Role Virmugen
Molecule Role Annotation A UL50 mutant is attenuated in pseudorabies virus and induces significant protection in pigs from challenge with the highly virulent NIA-3 strain of PrV (Jöns et al., 1997).
Related Vaccines(s) Pseudorabies virus UL50 mutant vaccine
References