VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

glycoprotein M

Gene Name glycoprotein M
NCBI Protein GI 1478255
Other Database IDs CDD:177566
GOA:Q85041
InterPro: IPR000785
UniProtKB/UniProt: Q85041
Taxonomy ID 33703
Gene Strand (Orientation) ?
Protein Name UL10
Protein Length 525
Protein Note envelope glycoprotein M; Provisional
Protein Sequence
>gi|1478255|emb|CAA65905.1| UL10 [Suid herpesvirus 1 strain Kaplan]
MTYASESKYVTNPRPASSIRLARVRVKLRRQDRTSALISVAASAAESHFSSAVVLPEPIGARATRTRRQA
VSCGDGSSTGASRCRSRETPGQRLRTTAGRSQPYSIRASDTLEANAPPSSSAPPRRPPASAAMCGPRNAE
AVSWRSWLIEVCGFALAALTLVLTLIFASLPEMGFPCFYATVADYDTLNDTSGGVWTRQPLVAPALFLET
PTVTSFFGFTATVLLAHALYAVAGAVVLRREAGRLAFQPSVVLYAASTVAAPGTLMLGALCAWTLQAVVL
LMAHKQAGLAAAAYITHFVFLALFGACHACKGTGDVRAALAASPPLRRVAVHARAVVTNVVLGAVGLGAA
VVGLMLGVLLANSFHISLWKTAEAALAVFTLLALALMVFVEVVVSGYVQVLPTPAFCVLVASAAFGVSAH
RYFAKFSEALGETHGVVIGTRAVLAVLSLIALAMIVVRLVRACIAHRARGSRFYANVDKARTTARRYLQK
RLHGRGNDEYLLAPGSGDDEFDDGDEVVYENLGFE
Molecule Role Virmugen
Molecule Role Annotation A glycoprotein M, gM, deletion in pseudorabies virus was attenuated and induced protection in piglets against intranasal challenge with 108 p.f.u. of the highly virulent PrV strain NIA-3 ((Dijkstra et al., 1997).
Related Vaccines(s) Psuedorabies virus glycoprotein M mutant vaccine
References