VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Glycoprotein G

Gene Name Glycoprotein G
Sequence Strain (Species/Organism) Rabies virus
NCBI Gene ID 1489856
NCBI Protein GI 9627201
Locus Tag RABVgp4
Genbank Accession M13215
Protein Accession NP_056796
Taxonomy ID 11292
Gene Starting Position 3290
Gene Ending Position 4963
Gene Strand (Orientation) +
Protein Name mRNA
Protein pI 7.51
Protein Weight 54466.92
Protein Length 524
DNA Sequence
>gi|9627197:3290-4963 Rabies virus, complete genome
TAACATCCCTCAAAAGACTCAAGGAAAGATGGTTCCTCAGGCTCTCCTGTTTGTACCCCTTCTGGTTTTT
CCATTGTGTTTTGGGAAATTCCCTATTTACACGATACCAGACAAGCTTGGTCCCTGGAGCCCGATTGACA
TACATCACCTCAGCTGCCCAAACAATTTGGTAGTGGAGGACGAAGGATGCACCAACCTGTCAGGGTTCTC
CTACATGGAACTTAAAGTTGGATACATCTCAGCCATAAAAATGAACGGGTTCACTTGCACAGGCGTTGTG
ACGGAGGCTGAAACCTACACTAACTTCGTTGGTTATGTCACAACCACGTTCAAAAGAAAGCATTTCCGCC
CAACACCAGATGCATGTAGAGCCGCGTACAACTGGAAGATGGCCGGTGACCCCAGATATGAAGAGTCTCT
ACACAATCCGTACCCTGACTACCACTGGCTTCGAACTGTAAAAACCACCAAGGAGTCTCTCGTTATCATA
TCTCCAAGTGTGGCAGATTTGGACCCATATGACAGATCCCTTCACTCGAGGGTCTTCCCTGGCGGGAATT
GCTCAGGAGTAGCGGTGTCTTCTACCTACTGCTCCACTAACCACGATTACACCATTTGGATGCCCGAGAA
TCCGAGACTAGGGATGTCTTGTGACATTTTTACCAATAGTAGAGGGAAGAGAGCATCCAAAGGGAGTGAG
ACTTGCGGCTTTGTAGATGAAAGAGGCCTATATAAGTCTTTAAAAGGAGCATGCAAACTCAAGTTATGTG
GAGTTCTAGGACTTAGACTTATGGATGGAACATGGGTCGCGATGCAAACATCAAATGAAACCAAATGGTG
CCCTCCCGGTCAGTTGGTGAATTTGCACGACTTTCGCTCAGACGAAATTGAGCACCTTGTTGTAGAGGAG
TTGGTCAAGAAGAGAGAGGAGTGTCTGGATGCACTAGAGTCCATCATGACCACCAAGTCAGTGAGTTTCA
GACGTCTCAGTCATTTAAGAAAACTTGTCCCTGGGTTTGGAAAAGCATATACCATATTCAACAAGACCTT
GATGGAAGCCGATGCTCACTACAAGTCAGTCAGAACTTGGAATGAGATCATCCCTTCAAAAGGGTGTTTA
AGAGTTGGGGGGAGGTGTCATCCTCATGTAAACGGGGTATTTTTCAATGGTATAATATTAGGACCTGACG
GCAATGTCTTAATCCCAGAGATGCAATCATCCCTCCTCCAGCAACATATGGAGTTGTTGGTATCCTCGGT
TATCCCCCTTATGCACCCCCTGGCAGACCCGTCTACCGTTTTCAAGAACGGTGACGAGGCTGAGGATTTT
GTTGAAGTTCACCTTCCCGATGTGCACGAACGGATCTCAGGAGTTGACTTGGGTCTCCCGAACTGGGGGA
AGTATGTATTACTGAGTGCAGGGGCCCTGACTGCCTTGATGTTGATAATTTTCCTGATGACATGCTGGAG
AAGAGTCAATCGATCGGAACCTACACAACACAATCTCAGAGGGACAGGGAGGGAGGTGTCAGTCACTCCC
CAAAGCGGGAAGATCATATCTTCATGGGAATCATACAAGAGCGGGGGTGAGACCGGACTGTGAGAGCTGG
CCGTCCTTTCAACGATCCAAGTCCTGAAGATCACCTCCCCTTGGGGGGTTCTTTTTGAAAAAAA
Protein Sequence
>gi|9627201|ref|NP_056796.1| transmembrane glycoprotein G [Rabies virus]
MVPQALLFVPLLVFPLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYI
SAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHW
LRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPGGNCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDI
FTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPGQLVNLH
DFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKS
VRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLVSSVIPLMHPLAD
PSTVFKNGDEAEDFVEVHLPDVHERISGVDLGLPNWGKYVLLSAGALTALMLIIFLMTCWRRVNRSEPTQ
HNLRGTGREVSVTPQSGKIISSWESYKSGGETGL
Molecule Role Virmugen
Molecule Role Annotation A glycoprotein G mutant in rabies virus is attenuated. After a one-dose intramuscular vaccination, the ERAg3m virus protected 100% of mice and hamsters from lethal challenge. In co-infections, using a lethal dose of street rabies virus mixed with ERAg3m, 100% of hamsters and 90% of mice survived and were protected against subsequent infection. (Wu et al., 2011).
Related Vaccines(s) BV-RVG/RVG , Rabies virus glycoprotein G mutant vaccine , RCN-rabies-G , rLSDV-Rabies-gP
References