VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

apxIIA

Gene Name apxIIA
Sequence Strain (Species/Organism) Actinobacillus pleuropneumoniae serotype 2
NCBI Protein GI 255959000
Locus Tag APL_0956
Genbank Accession CP000569
Protein Accession YP_001053657
Other Database IDs CDD:111291
CDD:116920
Taxonomy ID 715
Gene Starting Position 1095617
Gene Ending Position 1098487
Gene Strand (Orientation) -
Protein Name RTX-II toxin determinant A
Protein pI 5.34
Protein Weight 96054.51
Protein Length 956
Protein Note RTX N-terminal domain; pfam02382
DNA Sequence
>gi|126207488:1095617-1098487 Actinobacillus pleuropneumoniae L20, complete genome
ATTAAGCGGCTCTAGCTAATTGAATATTATTCGAGACATCTATTGATGAAGGAACATATGTTCCTAAATT
ATTCCTAAAGTCTGAGGAAGACGTAAAGCTCCCGACTGAAGAAATCAATTTTGCTAAGCTATTAGATACG
TTCTGTCTATCTTTACTCGTATTGTAATCATTCACAACTTTGGATAATGCTTCTGCAGAGATTTGATTGT
TACCCTCCTTAATCAGTTTATCAACTTGTTCTGATGTAATACGTTCTCCTCCTTTACCAATAATTTCCTC
AATTTTTCGGTCATTCGTAGCTTTATAGTTAGCAACTGTGCTAGCCAAATCATCTTCTAAGAACCAATTC
CCAATACGAACTTTTTCTCCTTTTTGATTAATGATTTCGAGAGAAGAATCTACTTTCTTAAAGGTGAGGT
CTTTAAGATTTACATCCGAAAATGCCAGTGTATCTTGTCCGCCAGAGTCTGTAATAGAATCATTTCCATC
GCCTGTTTTATGGACATATATATCATTATCTTTACCTCCCGAGATAATATCATTACCGGTTCCTCCAACA
AGGAAATTGTTACCGTTTCCTCCATCGATAACATCATCGCCTGCGCCACCAAATAAATGATCGTCACCAT
CGTTACCATCAATAGTGTCTACACCATTACCACCATGGAACACATCATCAAATTGGCTTCCTTTGAAAAT
ATCATTAAATTGTGAACCAATGATCTCTTCAACTGATTTGAGTGAGTCCGTCACAGTATAACCAGTATGA
AAACGATCATCTTCACGACGATATTCAATTTTTTCTTCACGATTACCAACATTTGTTTGGTGGGTGGCAA
TTGTTTCATGTAATGCTTTACTGTCTCCGACATAGCGTTTTACTGAATATGAGCCTTTTTCTGTCTCGGC
TGTAGCATCAATAACTAATGCGCCATATTCTCCTCTACTGTAGTGAACTCGATCATGTCCGTCCCCGCCA
TCAATAACGGTAGTACTTGACCCAACAAATACATTATCGTTACCAGCACCTAAATTTGCGATAATTTTAG
TATCTTTAGATTCGATAATGTTACCTGCATCATCAAATTTCACAGCGATTCGTTGTACTACATTAGTGAA
ATCTACGCTTGAGCTAGCATCACCATCTGTTACAGTCCAACTGTCAACTCTTTGTATATGTAATTTTGTA
ATATAAGAATTTTTACCTTCCTGAATACGTTCCCGATTCTCTTCACCTGGAGTTAGTAATGGAGTTCTGA
ATAAAACACTTTGTGTCTTTCTATTTGTATTACTAATATTAATAATACCGTTTTTGTTATCTAGCTGTAC
GGATGAATCGTAGGACTGGTGTTGCCCCTCCTCAAAAGCATCCACATAAGCTTTTCCACTGGAAATTTTA
TCCGTTCTACGGCTAATTGCCGCTAGGTCTCCAATTTGGTTATCCCATCTTTGTTGGGTAATAGCTACTA
CGCGTTCAGCCTGAAGTTCTTTATTTAAATTGATAAGAAACTTCATATTGTCTTGTAAATCAGCTAAATG
ACGAGAATCATAACCTTGCTCAAAATAGTTTTTATTATGTTTTTTCTCCCATTCAACTATTCTGTCATGA
ACCTTATTTGCAACATGTTCAAACATGGCTTGTTTAGAATATTCTAGAATAGTTGTAATAAGTCCCGTAA
CACCAGCAACGAGTAACGCAACTGGAGCTCCGACTAGAGAACCCGCGCTTGCAGCTCCAACTCCACCGGA
GATAGCTGCTAAAGCAGTGTTAATTGTTGTTACAGAAGCATCAATAGTTCCTGTCTCACGGTGAAAATCA
GCTAATAAACGATCTCCATCATATCCTAATTTTTGGAAGCGTTCAGAATATGATTTGATTAAATCAGCTT
GTTTAAACTTATCAGCTACATTTAAGAATGAAAGAGGGCTAACAGCTAGTGCAACTGTAGATGCGATTAA
TGCAGCGACAGGACCAGTTGAAGACAAACCTGAAGCGACTCGTTGGGCAAGAATGTAAGATGAGACCGCT
TTTGTTACATTACCTATAATTTGGTTAGCAAATTCTACACCTGCGGCAGCTTTCTTTTCTGTTGAAGCCT
CTTTATCTGCTAAAATGAGACCTGCAGATGCTCCAGAAAGTAAACCAGAGATAATGTCCAAACCTAAACT
TGCTTTTCCTAGATCTGGTAGATTTTGTAATTTATTACTCAATCCTCCTAATCCTTTCACATTCTGTAAA
TGTGAACCTAGTTTAGATATTTGTTCTGCAAATGCATCTACAGTTTGCACCGAGCTAGCAATATTACCAA
CTAATTCATTAGTCAGTTCTAGCCCTGCTTTTGCAAGTTCTAATTGATTAGGATCTTTATTTTGAAGTAA
TTCATTCAGATTTACTCCAGATAAAACAGATCCTAAAATAGATTGAATACCACCTAATACAGTATTGGCT
TTACCTATATTTTGTGAGATGCTAGAAGCACTTCCTAATGTATTGCCAATTTTAGGATTCTTCTTTAATA
AATTATCTAGCTGAGGTGCAAATAATACAATTCCTCTATCAGTAAAACCTAGAATTTTCTGAGTTGTATC
AAAGCTAGTTTTTGCAATGTCCAAATTGCTGCGTTCTTCTCGCCATACTTCAATACCTAAATCATTAGCA
GCTTTAACTAAATCTTGAACTCCATTTCCTTGACCCGAATCATAGCCTTGAGGAATATATAAGATTAATT
TTTTAGCCCCATTCTGTAGAGAATGACCAGTTTGAGTTAAACCATTCTTCAGTGTTGTACCTGCTTGATT
TAACTTGTTTTTCCCATTTTTCAATCCTTGTTGTAAGGACGATTTTAATGATGACAAAGTGATTTTTGAC
A
Protein Sequence
>gi|255959000|gb|ACU43588.1| RTX-II toxin determinant A [Actinobacillus pleuropneumoniae]
MSKITLSSLKSSLQQGLKNGKNKLNQAGTTLKNGLTQTGHSLQNGAKKLILYIPQGYDSGQGNGVQDLVK
AANDLGIEVWREERSNLDIAKTSFDTTQKILGFTDRGIALFAPQLDNLLKKNPKIGNTLGSASSISQNIG
KANTVLGGIQSILGSVLSGVNLNELLQNKDPNQLELAKAGLELTNELVGNIASSVQTVDAFAEQISKLGS
HLQNVKGLGGLSNKLQNLPDLGKASLGLDIISGLLSGASAGLILADKEASTEKKAAAGVEFANQIIGNVT
KAVSSYILAQRVASGLSSTGPVAALIASTVALAVSPLSFLNVADKFKQADLIKSYSERFQKLGYDGDRLL
ADFHRETGTIDASVTTINTALAAISGGVGAASAGSLVGAPVALLVAGVTGLITTILEYSKQAMFEHVANK
VHDRIVEWEKKHNKNYFEQGYDSRHLADLQDNMKFLINLNKELQAERVVAITQQRWDNQIGDLAAISRRT
DKISSGKAYVDAFEEGQHQSYDSSVQLDNKNGIINISNTNRKTQSVLFRTPLLTPGEENRERIQEGKNSY
ITKLHIQRVDSWTVTDGDASSSVDFTNVVQRIAVKFDDAGNIIESKDTKIIANLGAGNDNVFVGSSTTVI
DGGDGHDRVHYSRGEYGALVIDATAETEKGSYSVKRYVGDSKALHETIATHQTNVGNREEKIEYRREDDR
FHTGYTVTDSLKSVEEIIGSQFNDIFKGSQFDDVFHGGNGVDTIDGNDGDDHLFGGAGDDVIDGGNGNNF
LVGGTGNDIISGGKDNDIYVHKTGDGNDSITDSGGQDKLAFSDVNLKDLTFKKVDSSLEIINQKGEKVRI
GNWFLEDDLASTVANYKATNDRKIEEIIGKGGERITSEQVDKLIKEGNNQISAEALSKVVNDYNTSKDRQ
NVSNSLAKLISSVGSFTSSSDFRNNLGTYVPSSIDVSNNIQLARAA
Molecule Role Virmugen
Molecule Role Annotation Deletion in ureC and apxIIA genes of Actinobacillus pleuropneumoniae serotype 2 prototype provides attenuation and protection in pigs against challenge with the virulent parent strain of A. pleuropneumoniae (Tonpitak et al., 2002).
Related Vaccines(s) Actinobacillus pleuropneumoniae ureC and apxIIA double mutant deletion vaccine , rS.C-APP-ApxIIA
References