VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

gp50

Gene Name gp50
Sequence Strain (Species/Organism) Suid herpesvirus 1
NCBI Gene ID 2952548
NCBI Protein GI 51557533
Locus Tag SuHV1_gp50
Genbank Accession BK001744
Protein Accession YP_068367
Taxonomy ID 10345
Gene Starting Position 83052
Gene Ending Position 86540
Gene Strand (Orientation) +
Protein pI 9.08
Protein Weight 46944.96
Protein Length 470
DNA Sequence
>gi|51557483:83052-86540 Suid herpesvirus 1, complete genome
CATGTTCGCCTACGTGAAGCCGATGGCGCACGGCCCGGACATGGCCTCCGTCTACCAGTCCACGGGGCGC
GTGCGGCGGCTGCTGCGCGACGAGCTCTTCGTGTACGTGGACGGCTCCGGCGCGCGCGGCGAGCCCATCT
TCACGCCCGTGCTGCTGAACCACGTCGTGGGCTCGGGCTGGCCGGCGCGCCTGTCGCAGGTGACGAACCT
CGTGTGCGCGCAGTTCCAGCGCCGCTGCCGCCCGGCGTTCGCGGCGGCGCGCGGGATGCGCCTCTTCTCC
CGCTTCAAGTTCAAGCACCTGTTCGAGCGCTGCACGCTGACGAGCGTCAACGACAGCCTCAACATCCTGC
ACGCGCTGCTGGAGAACAACCGCCTGCGGGTGGCGCTCGAGGGCTGCGAGCCGCCGCTGACGGCGCGCGC
CTTCTGCGACTTTCTGCGCGACGCGCGCCTGGACGCCTTCGCCAGCCAGCAGGTGCTGCGGCAGCTGCGC
CCCCCGGACCGGCCGGTGGCGGCCGACATCGCGGACAGCGGCGAGGTGGCCACCTTCGTGGAGAAGTACC
TCGTGGCCGACGTGCCCGAGGACGAGCTGCAGGAGCTGCTGCGCGCGCTCGCCAACCCCGTGACGCGGGA
GCAGTTTGTGGGCCTGGCCGTGCTCGGCGCGTGCGCGCGCGTCCCCGAGGCGCTGCGCAGCGAGCGCGTC
TTCGGGGCCGTGTACGGGCACTACGCCTCCGGGGCCGTGCCCGTGGTGGCCGACGGGCGGCTGGAGCTGG
CGGCGCTGGCCCCCGACTTCAACGTGCCCGCGCGCTGGGCCCTCACGCGGCGCTGCGCGCGCGTCGCGGA
GGCCGCCGGGCTCTTCGAGGGCGCCTCGCCGGAGGTGGACTCGGCCGCGGTCGCGGCGGCGGCGGCCGAC
GCCGAGCTGGCGCCGCTGCTGCTCGAGGTGCTGCGGTGCCACGTGCTGGACGCGACGACGGCCGCGCGGC
GCCCCGTGCGCGCGGCCCTGAGCGCGCTGGGGGCGGGCGGGGGCGCGGGCCCGCTGAGCCGCGGGCGCCA
CGCCGCGCTCGTGTTCAAGGTGATGTGGGAGGAGGCCTTCGGCGTGCGCGTCGGCCGCAGCCGGCAGACG
TTCCCGGGGCCCACGCGCGTGAAGAACCTGCGCAAGGCCGAGATCGCCGCGCTGCTGCGCGACGCCGGCC
TGGACCCGCCCGCGGGCGCCACCCACCGGCAGCTGTACGCCCTGCTGATGGAACGCCGGGGGGACTTTGC
GGGGGAGAGGTATAAACTGCGCCTGCCCGCCTGGAGCCGGCTCATGTACCTGACCCAGGGCGGCTTCGAC
GCGCCGCTGGACGCCGCGCTCTCGCTCGTGCCCGCGGAGGCGTGGCCGCGCACCGAGGGGGCCGTGGACT
TTGCGGCGCTATGACGGCCGCGGCGGGGGAGCGCGTGTGCGCGGCCGGGATCTACACGGCCTGGACGGAG
CCCGGCGCGCCGGGCGAGCTCCACGCGCTGGCGCACCTGCTGTGCCGCGACGGGGCCGGCGCGTACGCGG
CGCGCTTCGTCCACGTGACGGCGGCGCCGTGGACGGGCTCGGCGGCCGCGGTGGCCGCGGCGCTGCGCGA
CGCGAGCGGCACGGGGGCGCTGGCGGACCCGGCGCTGTGGCGCGGCGCGCACGGCGCGGTCATGGCGGCC
CTGCGCCGCGCCCTCCCGGCGCTGGCCTTCTACGAGCCGCTGCGCTTCGAGACGGACCCGGCCACGAACC
TGGTCACGGCCGCGACGCCGGCGGGCGGCGGCGGCGAAGAGGAGACGACCGGGGAGGGCGGCGAGGAGGA
CGAGGACGAGGCCGGCCCGCGCGCGGGCATCATCCACGTGGACGCCGACGTCGTCGTGGACCGCGACGCC
GCGCGCGCGCACGCCACCGAGGCGTGGCTGCCGCACGCCCAGCTGCGCGCCATGGCCGGCTGCGCCGCGC
TCTCCGTCGAGATCACGACGCGGCGGACCAGCTTCGCGCGCGCCTACGCGGAGGCCGGCGCGCCGCCGCT
GAAACGCCGGGGCGAGATGAGCGACCCCTTTGACGTGCGCGAGACGGTGCTGCGGCCCGCGGGCCGGCGC
GTGGCGGCGCGCGTGCTCGTCCCGCGCGGCTTCGACTGCCTGGTGGCCCACGGCGTGAGCAACGCGGCGC
TGGTGGCGCTCTACCGCCGGTGGCACGCGGCCGCGTACGGCGCGGGCGACGCGACCCCGCCCGTCTTCGC
CTTCCTGGGGCCCGAGCTCGCCCGCGAGGGCGCGGACGAGGACTACTACTGCGCGCTGGGCTTCCCCCTG
TTTGCGACGATCAAGGTGGCCGCGGCCGCGCCGGAGGCGGTCCGCGGCGCGCTCGCCGCCCACCGGCTCA
CGGACGGGCTGTGGCCCGCGCTCGGCTTCCGCGCCTTCCACGCCCTCGGGCCCGTGAGCTGCGGCCTGCG
CCTGCGCTGCGACGTCTGGCCGGCGGGGCGCGCGACCAGCGCCGTGGAGCACCCGTGCGCCCTCCGCGGG
GCCTGGCTGGCCAAGTTTGACTTCGCGGCCTTCTTCCCCAACCTGTTTCTGGCCCTGTGCCCGGGCCACG
AGCGGCTGCGGCGCGCCGTGCGGGCGCGCGCGGTCAAGCCGGCGCTCGTGGCCTTCTTCGGCGGGCTCAA
GCACACGTGCCCGGAGGCGTACCACAGCGTCATCGCGCTGGCCAACGGGGTCTCGCGCGCCGTCGAGGCG
GCCGCGGCCGAGGCCGGCCTGGTCACGTGCGCCTACGTCAAGGACGGCTTCTGGGGCGTGCTCGGCGACG
TGCCCGCGGCCGCGCCGGAGGCGGCCGCCGCCGCCGCGGCCGAGCGCGTGCGCGTCGCCTGCGAGGCCGC
CGCGGCGCGGCACCTGGCCGACGCGGGGGCCGCCGCGACGGACGTGACGCTGCGCTGCGAGGGCGTCTTC
GACGCGGCCCTGGCCTGGTCCTGCCACGCCTACTGGCTGCGGCGGCGCGAGGGCCCCGCGGACTTTGTCG
GCTTCCCGTCGCGCAGCGGCTTCGGCCGCGCCGCCAAGGCCGCGCTGGACGCCCTGCTGCGCGAGGCCGT
CGAGGGCCGCGCGGACGCCGAGGCCGCGCGCGCCGCCTGCGACGGCCTCGTCGAGCGGGCCTTCGCCTCG
CGCCACGACCCCGACTTCTGGGCCGCGCCGGGGGACGCCCTCGCCCCCGCCGCGTGCGCAGGGGCGACCG
CCGGGCGCGGCGGCGCGCGCTGCTCGCGGCGCTGCGTGCGCCTGCGCGGCGCCGGCCCGGTGCCCTACGA
GCAGCTGCGCCCCCCGCTGATCCTGCCCTGGATAGACTGTCTGGCCCACATGGAGCCCATCTTCGCCGCC
CTCGTCGGCATGTACAACCGCGCGCTCGAGGCGCTGAGCGCCGGCGACGCCCCGCCGCCATTTGTGTTTA
CATACACGCCGGACGCGTTTCTGTTTGGGTAAACAATAAAGTCTGTTTATTGTCAGAAC
Protein Sequence
>gi|51557533|ref|YP_068367.1| UL8.5 protein [Suid herpesvirus 1]
MFAYVKPMAHGPDMASVYQSTGRVRRLLRDELFVYVDGSGARGEPIFTPVLLNHVVGSGWPARLSQVTNL
VCAQFQRRCRPAFAAARGMRLFSRFKFKHLFERCTLTSVNDSLNILHALLENNRLRVALEGCEPPLTARA
FCDFLRDARLDAFASQQVLRQLRPPDRPVAADIADSGEVATFVEKYLVADVPEDELQELLRALANPVTRE
QFVGLAVLGACARVPEALRSERVFGAVYGHYASGAVPVVADGRLELAALAPDFNVPARWALTRRCARVAE
AAGLFEGASPEVDSAAVAAAAADAELAPLLLEVLRCHVLDATTAARRPVRAALSALGAGGGAGPLSRGRH
AALVFKVMWEEAFGVRVGRSRQTFPGPTRVKNLRKAEIAALLRDAGLDPPAGATHRQLYALLMERRGDFA
GERYKLRLPAWSRLMYLTQGGFDAPLDAALSLVPAEAWPRTEGAVDFAAL
Molecule Role Virmugen
Molecule Role Annotation A gp50+gp63 deletion mutant in Pseudorabies virus was attenuated and provided protection from clinical signs of Aujeszky's disease after a challenge inoculation with the virulent wild-type PRV strain NIA-3 (Peeters et al., 1994).
Related Vaccines(s) NYVAC-PRV- gII/ gp50 , Pseudorabies virus gp50/gp63 mutant vaccine
References