VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

gp63

Gene Name gp63
Sequence Strain (Species/Organism) Suid herpesvirus 1
NCBI Gene ID 2952540
NCBI Protein GI 51557548
Locus Tag SuHV1_gp63
Genbank Accession BK001744
Protein Accession YP_068382
Taxonomy ID 10345
Gene Starting Position 102695
Gene Ending Position 107803
Gene Strand (Orientation) -
Protein Name transcriptional regulator ICP4
Protein pI 8.04
Protein Weight 141692.15
Protein Length 1446
DNA Sequence
>gi|51557483:102695-107803 Suid herpesvirus 1, complete genome
CAGAAAATACAGCACAAACTTTATTTTCTCACTCTGAAAACAAACTCTTTTCTCACCCGATGGGAGAAGG
AGGAGAAGGGGACCGGGGGACCGCGGGAGGAGGAGAAGGGGACCGGGACGATCCTCCGCCGCCGAGCCCT
CCGCCGCGGCCGCCGCCGCCGCTTCCACCACCGCCGCCACCTCCGCCGCCGCCGCAGCCACCTCCGGCCG
GGGGATCCGCGCGGAGGAGAAGGAGAGGAGGAGGGCCACCGGGCCGGGGAGGCAGGCGCCGGGGAGGCAA
GCGCCGCCGGGCCGAGGGGACCGAGGCCGCCGCCGCGGACGCAGAGGAGGAGGAGGACGGGGACGGGGAC
GAGGACGAGGACGAGGACCGGGCCGAGGGCGAGGGGAGAGAAGACGGAGGAGAAGGGCCTCGAGGAGCCG
GTGGAGGGGCCGGAGAGTCAGAGTCAGAGTCCGGCCGGGCCGAGGGGGCGCCCCGCTCAGCGGAGCAGCA
GGTAGGGGTTGCCGGCGTCCTCGGCCTCCTCGTCGTCCGAGATGGCCTCCACCTTGATGGGCCCGAGCGG
GCCGCGGGGCCGGCCGTCGCCGCCGCGGACGCCGACGATCTCCACAGAGTCCCCGTCCTCGCCGGGGCCG
GCCCCGGCGCCCGAGGCCCCCGCGGGCCGGTGGGTCTCCACGGCGCCCCCGGCGGCGGCGCGGACGCTGG
TCTCGAAGGGGGCAAAGTCCCAGAGCACGGCCGGCGGGGCGCCCGCGGCGGCGACGGCGCCCGGGGTCAG
CACCAGCGGGGCGGCCTCGGCGTCGGGCTCCAGCAGCGCCGCGGCGCAGAAGGCGCGCAACTCGGCCGGC
AGGCCCTCGGGGCCGCGGAGCTCGGCGAGGCCCCGGCGGCCGCAGGAGACGAAGACGGGCCGCAGCGGGG
CGCCGAGCCCCCAGCGGTTGGCCGCGCGGTGCCCGAAGGCGGCGCCCGCGTCAAAGTCCGGGTCCCCGAG
CCCGAGCGCGGAGCGCTGGCGGGCCATGTCCTTGCAGCCGTCCACGGTGGGGAGCACGCGCTGGCGGTAG
GCGCGCGGCGGCAGCGGGACCGGGGTCCGGGGCCCGGCGCGGGTGCTCACCGTGTAGCGCACGTTGTCCT
GGCGGCAGAGGCGCAGCGGCTCGGCCCCGGGGTGCAGGCGGGCGAAGGAGGCCTCCACGCGGGCGAAGCA
GGCCGGGCCCACGATGGAGCTAGAGTCCAGCACGGCCGCGCGGAGCTCGCGGCACCCGGGCCAGCGCACG
GCGCACTGGGCGGCCGGGTCCAGGCGGACGCGGACGTAGACGTGGTAGTCCCCCACGGCCGGGCCGTCCG
CGGGCCAGTCCTCGATGGTGTCCAGCACGATGAGCCGGCGCCGCGCCGCGCCGAGCCGCGAGCAGAGGTA
CTCCACGGCGCCGGCGAAGCCGAGGTCCCGCGCCGAGAGCAGCAGCACCCCCTGGGCGTTGAGGCGGCCG
ATGTCGGGGCGCCCGGTCCAGTTCCCGGCCCAGGCGTGCGAGTCCGGCGTGCAGAGGCGGTGGGCGAAGG
CGGCGAGCAGCGCCGAGAGGCCGCCGCGGCGCGGGTCCCAGGCCGGGCGCGGGGCGCCCTCGGCGGGCTC
GGCGCAGAGCTCCTCGTGGGGCAGCGGGTCGTAGAGCACCACCACGCGCACGTCCTCGGGGTCGGCTATC
TGCCGCATCCAGGCGGCGCGGCGGCGGAGCGGGGCGCCGCGGCGCGCGGCGATGTGCGCCAGGGCGGCCG
GGTCGAAGGTGAGCGCCGGGCGCCAGAGTTCGGGGAAGACCTCCTGGTCCACGAGGGCGCGGGCCACCTC
GGGCGGGCAGTAGGCGGCGAGGGCCGCCTCGGAGGGCCGCGGCGTGTGGGTCTCGCCGGCCGGGACGCGG
CGGAAGCCGCCGTCGGGCGCGGGGTGCTCGGGCATGGGCCCGAGCGGGCGCCGGAGCCGGTCGTCCTCGG
AGGAGGAGGAGGAGGAGGACAGCAGCGCGGGAGCGGGGTCCGGAGCGGGCCCGAGTCCGAGGGAGCGGCG
CTTGCGCCGGGGCCCCCGGTCCTCTTCGTCGTCGCGGTGGCCGTGGCCGTCCCCGCGGAGGGCCGCGCCG
GAGAGCCCCTCGTCCTCCTCGCCGTCCCCGGGGCGGCGGGCCCCGGGCGCGCGGCGCTTCTTCTTGCGCC
GCTCGGGCGCTGGGTCCGGGCCGGCGGCGGGGGAGCTGGCGTAGCCGGAGGAGCCGGAGAGGCCGGACTT
GGTGCTGGAGCTGGACTTGGTGCTGGAGCTGGACTTGGTGCTGGCGGGGCTGGAGGGCCCGGAGCCGGGG
AGGCCGGAGGGGGCGCCCGCCGCCGCCGGCGCCGGCGCTGGGACGACGAGGCCGGGCTGCTCGGGCCAGA
GCGGGGGCAGGCCGGGCGCGGGCTCCGCGGGCCCGGGCCGCGCGGCGGCCTCGGCGAGCCGGGCCGCGGC
CACGTTGGCCGGGGCGAAGAGGGCCGCGGCGTAGGTCCAGGCGGCCTCGCGGGCGCGGGCCCCGTCCACG
CTGTAGCGCACCAGCGGCGCCACGGTGCGGGCGACGAGGGCGACAGAGTCCGCGGCCTGCCGCCGCTCGG
CCGGGCCGGCCCCGGGGATCGCGTCGCGGAGCGCGAGCAGCGCGGCCGTCACCTCCTCGAGGCAGGCGGG
CCCGAGGGCGGCCGGGGCGCGGGCGGGCGCGGGCAGCCGGAGCGGGCAGGGCAGCAGGCGCTCGAGGACG
CCGCGGCAGGCCAGGACGCAGGCGTCCGCCAGCTCGCGGGGCACGCGGCCGGGCTGCGCGGCGGCGAAGG
CGGCGCGGACGCGGGCGCAGAGGGCCTCGACGGTCGCCTCCCCGGCGCGGGGGTCCGCGGCGCGGCCCGG
GTAGGCCATGTCGGCGTAGGCCCGGCGGAGGCTCTGCAGGATGAAGGTCTTCTGGGTGCGATCGTAGCGG
CGGCTCATGGCCACGGCGCTCACCGCGTGCGGCAGGGCCCAGAGCGGGTCCTGGGCGGCCATGGCGTCCC
CGATGTGCGGCAGCGGCGGGGTCACGCTGCCGGTGATGAAGGAGCCGTGGCCGTGGGGCGCGTGGACCCG
GCGCTGGCAGAACTGGTTGAAGCGCTGGTCGGGGGCCTGCATCCGCGGGTTCTGCAGCCAGGACATGGCC
TCGCCGGCGGCCCCGCTGTAGATGAGGCGCACGAGGGCCTCGTGCTGCTTCCTCGAGTCCCCCATCTCCG
GGATGAAGACGGGCACGGGCCCGGCCGCGGCGCGGTAGCGGGCCGCGGCCTGGCGGACGTCGTCCTCGTC
CCAGAGCCCCTCGCGGGAGTCCCCGGCGCCGCCGTAGCGGACGCGGCCGTCGGCCGGAGGGTCGGAGCCG
GGCCAGGGCTCCCCGAGCGGGGTGAGCAGCGGCCCGTCGGTCGGCGGGGGCCCGTCGGCCATGAGCGAGA
GGTGGTTGTTGGTGGAGCGGCGCTTCCTGCGCGGGGGCCGGGCGGGCTCCGGGGCCGGGGCCGGGGAGGC
CGCGGCGGAGGAGGAGGCGGAGGAGGCCGAGGGCCGCGGGGCCGCGGCGGGCGCCGGCGGAGACGGTGGC
GGCCCGGCGCGGGCGAGTGGGGCGCCGGGCCGGACTCCTTCGTCTTCTTCTCCCTCGGAGGAGGACGAGG
ACGAGGAGGACGAGGAGGACGAGGAGGACGAGGACGAGGAGGAGGCCGAGCGCCGCGCGGCGGCGGCGGG
GGCCCGGGGGGCGGAGGGCGAGCGGGCCGGGGAGAGGTCCGAGTCGCTGCCGCTGCTGCTGGAGCTGCTG
AAGCCGCGGCCGCGGCGGAGGGCGCCCTCTCCGGCGCGGCGCCGGCGGGGCTGTCTCTGCGGGGGCGCCC
CGCCGTCCCCGGCGAGGCCGAGTCCGTCCTCGTCCTTCTCGGGGCCGCGGGCGACGGTCTCGACGGCGAC
GGTGGTGGTGGAGTTGGAGTTGGAGTTGGGGTTGGAGGAGACGGGGCTCCGGGCGCCAAGCGGCCGAGGA
TCGAGCCGCCTCGCGGCGGCGGGCTCGTCGAGCAGGGGCTCGCGGTGCTGGTGATGGTGACGACCGCGGT
CCCCTCCGGCGGAGGGGGCGCCGCCGCCGCCGGGCGCCGAGACCGGCCCGGCGGCGGGGGAGGCTGGGGA
AGCGGGCCCCCGCCGTGCCGGCGCTGCGGCCACCGCTGCTGGCTGTGCTGGTGGCGCCGGGGTCCGAGGC
CGCGCCGCCGGCCCGGGCTCACCGACCGGGTCCCCCCTCGCGGGGGACCATCTCCGCGGGGCTGCCGAGG
GGCCGGGAGAGCCGGAGGAGGAGGCCGGGGAGGCTGCGGAGGGGGACGAGCGCCCGGGGCCGCCGGGGGC
CCCGGCCTCTGCCGCTGCGAGTGCTGCCGGGGTCGGCGGCCGGGGCCCGGAGCCGGCCCGGGACCGGGGC
CCGAGGACGAGGTGACCGTGCTCGGAGCCCTGATGGAGAGCCCGACCGGGGGACCCGGCGGCCGGGGACC
CGGGCTCGTCCTCCTCCTCGTCTTCGTCGTCTAGCACCACGATCTCGCCCGAGCCCCGGCGGGGCTGCTG
CTGCTGCTGGGCCGAAGGAGGACGGGGCGGCCTCGTGGCTCCGGCCGCGGCCGCGAGGACGGCGGCCTCG
GCCTCGGCGGCGTCGTCGGAGAAGAGGCCGCCCGGGCCGAAGAGGAGATCCTCGCCGGAGGAGCCGCGGC
GCCGGGAGCCCTGGCTGCCGCCGTCGGGGCCGGACGCGATGCCCTCTTCCTCGGCCGCGGCGGCGGCCGC
CAGGAGCTGGCTGAAGTTGCCCTCGGTCTCGATGAAGTCAAAGAGATCGTCGGCCATGGTCTCGATCGGG
GTCTTTCTGCCTGAGCGAGGCCGGGCGCCGAGCGCGGAGAGCGGGCGGCGGAGAAGAAGGAGGAAGGCGG
CCGGAGGAGGAGAAGAAGAAGACTCTTCTCTGGCGGGCCGAGAGCCTCGGTGGGTCGGGCGTCCGTCGAG
GGCTGATAGCCGCCGGAGAGCCGGAGTCTTCAGAGTCCGCGCCGGAGCGGAGACGGTCGGATCCCCTCGG
GTTGGCAGAGAACGATGCTGTCCGTACCTGCACCGCAGTGAAGTGCTACGATGGAGACCGCGCTTATAA
Protein Sequence
>gi|51557548|ref|YP_068382.1| transcriptional regulator ICP4 [Suid herpesvirus 1]
MADDLFDFIETEGNFSQLLAAAAAAEEEGIASGPDGGSQGSRRRGSSGEDLLFGPGGLFSDDAAEAEAAV
LAAAAGATRPPRPPSAQQQQQPRRGSGEIVVLDDEDEEEDEPGSPAAGSPGRALHQGSEHGHLVLGPRSR
AGSGPRPPTPAALAAAEAGAPGGPGRSSPSAASPASSSGSPGPSAAPRRWSPARGDPVGEPGPAARPRTP
APPAQPAAVAAAPARRGPASPASPAAGPVSAPGGGGAPSAGGDRGRHHHQHREPLLDEPAAARRLDPRPL
GARSPVSSNPNSNSNSTTTVAVETVARGPEKDEDGLGLAGDGGAPPQRQPRRRRAGEGALRRGRGFSSSS
SSGSDSDLSPARSPSAPRAPAAAARRSASSSSSSSSSSSSSSSSSSSEGEEDEGVRPGAPLARAGPPPSP
PAPAAAPRPSASSASSSAAASPAPAPEPARPPRRKRRSTNNHLSLMADGPPPTDGPLLTPLGEPWPGSDP
PADGRVRYGGAGDSREGLWDEDDVRQAAARYRAAAGPVPVFIPEMGDSRKQHEALVRLIYSGAAGEAMSW
LQNPRMQAPDQRFNQFCQRRVHAPHGHGSFITGSVTPPLPHIGDAMAAQDPLWALPHAVSAVAMSRRYDR
TQKTFILQSLRRAYADMAYPGRAADPRAGEATVEALCARVRAAFAAAQPGRVPRELADACVLACRGVLER
LLPCPLRLPAPARAPAALGPACLEEVTAALLALRDAIPGAGPAERRQAADSVALVARTVAPLVRYSVDGA
RAREAAWTYAAALFAPANVAAARLAEAAARPGPAEPAPGLPPLWPEQPGLVVPAPAPAAAGAPSGLPGSG
PSSPASTKSSSSTKSSSSTKSGLSGSSGYASSPAAGPDPAPERRKKKRRAPGARRPGDGEEDEGLSGAAL
RGDGHGHRDDEEDRGPRRKRRSLGLGPAPDPAPALLSSSSSSSEDDRLRRPLGPMPEHPAPDGGFRRVPA
GETHTPRPSEAALAAYCPPEVARALVDQEVFPELWRPALTFDPAALAHIAARRGAPLRRRAAWMRQIADP
EDVRVVVLYDPLPHEELCAEPAEGAPRPAWDPRRGGLSALLAAFAHRLCTPDSHAWAGNWTGRPDIGRLN
AQGVLLLSARDLGFAGAVEYLCSRLGAARRRLIVLDTIEDWPADGPAVGDYHVYVRVRLDPAAQCAVRWP
GCRELRAAVLDSSSIVGPACFARVEASFARLHPGAEPLRLCRQDNVRYTVSTRAGPRTPVPLPPRAYRQR
VLPTVDGCKDMARQRSALGLGDPDFDAGAAFGHRAANRWGLGAPLRPVFVSCGRRGLAELRGPEGLPAEL
RAFCAAALLEPDAEAAPLVLTPGAVAAAGAPPAVLWDFAPFETSVRAAAGGAVETHRPAGASGAGAGPGE
DGDSVEIVGVRGGDGRPRGPLGPIKVEAISDDEEAEDAGNPYLLLR
Molecule Role Virmugen
Molecule Role Annotation A gp50+gp63 deletion mutant in Pseudorabies virus was attenuated and provided protection from clinical signs of Aujeszky's disease after a challenge inoculation with the virulent wild-type PRV strain NIA-3 (Peeters et al., 1994).
Related Vaccines(s) Pseudorabies virus gp50/gp63 mutant vaccine
References