VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

bp26

Gene Name bp26
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. Rev.1
NCBI Protein GI 265991532
Other Database IDs CDD:194028
Taxonomy ID 520464
Gene Strand (Orientation) ?
Protein Name outer membrane protein Bp26
Protein Length 250
Protein Note Protein of unknown function (DUF541); cl01077
Protein Sequence
>gi|265991532|ref|ZP_06104089.1| outer membrane protein Bp26 [Brucella melitensis bv. 1 str. Rev.1]
MNTRASNFLAASFSTIMLVGAFSLPAFAQENQMTTQPARIAVTGEGMMTASPDMAILNLSVLRQAKTARE
AMTANNEAMTKVLDAMKKAGIEDRDLQTGGINIQPIYVYPDDKNNLKEPTITGYSVSTSLTVRVRELANV
GKILDESVTLGVNQGGDLNLVNDNPSAVINEARKRAVANAIAKAKTLADAAGVGLGRVVEISELSRPPMP
MPIARGQFRTMLAAAPDNSVPIAAGENSYNVSVNVVFEIK
Molecule Role Virmugen
Molecule Role Annotation A bp26 mutant in Brucella melitensis was attenuated and provided protection against challenge in mice (Cloeckaert et al., 2004).
Related Vaccines(s) Brucella melitensis bp26 mutant vaccine
References