VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

omp31

Gene Name omp31
Sequence Strain (Species/Organism) Brucella melitensis ATCC 23457
NCBI Gene ID 7676420
NCBI Protein GI 225853091
Locus Tag BMEA_A1674
Genbank Accession CP001488
Protein Accession YP_002733324
Taxonomy ID 546272
Chromosome No I
Gene Starting Position 1588634
Gene Ending Position 1589242
Gene Strand (Orientation) +
Protein Name outer membrane protein Omp31
Protein pI 4.8
Protein Weight 20497.92
Protein Length 202
DNA Sequence
>gi|225851546:1588634-1589242 Brucella melitensis ATCC 23457 chromosome chromosome I, complete sequence
TGTGTTGCAATATAGTGACAGACATTGGAGCCCATATTGGGCCCAAGATTTTTCAGGTTCGCTCGACGTC
ACGGCCAGCGGCTTTGTTGGCGGCGTTCAGGCCGGTTATAACTGGCAGCTTGCCAACGGCCTCGTGCTTG
GTGGCGAAGCTGACTTCCAGGGCTCGACGGTTAAGAGCAAGCTTGTTGACAACGGTGACCTCTCCGATAT
CGGCGTTGCAGGCAACCTCAGCGGCGACGAAAGCTTCGGCCTCGAGACCAAGGTTCAGTGGTTTGGAACG
GTGCGTGCGCGCCTCGGCTTCACCCCGACTGAACGCCTGATGGTCTATGGTACCGGTGGTTTGGCCTATG
GTAAGGTCAAGACGTCGCTTAGCGCCTATGACGATGGTGAATCGTTCAGCGCCGGAAACTCTAAGACCAA
GGCTGGCTGGACGCTTGGTGCAGGTGTAGAATACGCCGTCACCAACAATTGGACCCTGAAGTCGGAATAC
CTCTACACCGACCTCGGCAAGCGTTCCTTCAATTACATTGATGAAGAAAACGTCAATATTAACATGGAAA
ACAAGGTGAACTTCCACACCGTCCGCCTCGGTCTGAACTACAAGTTCTA
Protein Sequence
>gi|225853091|ref|YP_002733324.1| outer membrane protein Omp31 [Brucella melitensis ATCC 23457]
MLQYSDRHWSPYWAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKSKLVDNGDLSDI
GVAGNLSGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYDDGESFSAGNSKTK
AGWTLGAGVEYAVTNNWTLKSEYLYTDLGKRSFNYIDEENVNINMENKVNFHTVRLGLNYKF
Molecule Role Virmugen
Molecule Role Annotation A omp31 mutant in Brucella melitensis was attenuated and provided protection against challenge in mice (Cloeckaert et al., 2004).
Related Vaccines(s) B. melitensis DNA vaccine encoding Omp31 boosted with Omp31 , Brucella melitensis omp31 mutant vaccine
References