VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

mntA

Gene Name mntA
Sequence Strain (Species/Organism) Bacillus anthracis str. A0248
NCBI Gene ID 7848141
NCBI Protein GI 229600559
Locus Tag BAA_3238
Genbank Accession CP001598
Protein Accession YP_002867390
Taxonomy ID 592021
Gene Starting Position 2936644
Gene Ending Position 2937579
Gene Strand (Orientation) -
Protein Name manganese ABC transporter, manganese-binding protein
Protein pI 5.78
Protein Weight 32608.66
Protein Length 311
Protein Note identified by match to protein family HMM PF01297
DNA Sequence
>gi|229599883:2936644-2937579 Bacillus anthracis str. A0248, complete genome
TTTACTTTTGTAACCCATTAATAATGGTATCTATATTCCATTTCATCATTTTTAAATACGTATCTCCATC
CTCACCTGATTTACCTAGTGAATCTGTAAAAATTGTACCTGCAATTGGCACGTTTGTTTCTTTTGAAACA
GTTTCCATGCTGCGTCGATCTACACTAGTTTCTACAAATAGAGCCGGAACTTTATTTGTTTGAATTACAC
TTACAACATCTCGAATTTGATCTGGTGTACCTTGATTTTCTGAGTTAATTTCCCAAATGTATCCCGTTTT
AATATCATATGCTTTTCCAAAGTATTTAAAAGCACCTTCACTAGAGATTAAGAACCGTTTCTCCTCAGGG
ATTTGATGAATTCTGTTTACTGTCTCATCATGTAACTTTTGAAGTTCTGCTACATAGTTGTCAGCATTTT
TAGTATAGAACTCTTTATTTTTAGGGTCTTCTTTAATTAATGCCTTTTTCACATTTTCAGCATATAAAAT
ACCATTTTTAATGTTCATCCATGCATGCGGGTCTGGTTCTTTTTCTAATCCTTTTGTCTCTAAATAAATA
GCTTCTACGCCTTCACTTACTTTATAAACCGGTGCATCTTTCTCTGATTTATTTGCCGTTTTTAATAGCT
TTTTAAACCACGCTCCACCTTCTTCTAGGTTCAATCCATTGTAAAGAACCATATCTGCATCTGTCATTTT
CATAACATCTTTTGGTAGTGGATCATATTCATGCGGGTTAGCTCCAATTGGAACAAGACTATGAATCTCA
ACTTTCTCTCCGCCAATTTGCTTCACCATATCATATATAATGGAGTATGTAGTTACAACTTTTAATTTTC
CACTGCCCTCTTCTTTTCCATTTGTGTTACTAGAACACGCTGTTAATGCAAATACGAAAATACAAAGTAT
CGATAATACAACATTTTTAAATTTCA
Protein Sequence
>gi|229600559|ref|YP_002867390.1| manganese ABC transporter, manganese-binding protein [Bacillus anthracis str. A0248]
MKFKNVVLSILCIFVFALTACSSNTNGKEEGSGKLKVVTTYSIIYDMVKQIGGEKVEIHSLVPIGANPHE
YDPLPKDVMKMTDADMVLYNGLNLEEGGAWFKKLLKTANKSEKDAPVYKVSEGVEAIYLETKGLEKEPDP
HAWMNIKNGILYAENVKKALIKEDPKNKEFYTKNADNYVAELQKLHDETVNRIHQIPEEKRFLISSEGAF
KYFGKAYDIKTGYIWEINSENQGTPDQIRDVVSVIQTNKVPALFVETSVDRRSMETVSKETNVPIAGTIF
TDSLGKSGEDGDTYLKMMKWNIDTIINGLQK
Molecule Role Virmugen
Molecule Role Annotation An mntA deletion mutant, generated by allelic replacement, in Bacillus anthracis was attenuated and provided protection for guinea pigs against lethal spore dose (60 LD50) of the virulent B. anthracis Vollum strain (Gat et al., 2005).
Related Vaccines(s) Bacillus anthracis mntA deletion mutant vaccine
References