VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

relA

Gene Name relA
Sequence Strain (Species/Organism) Mycobacterium avium subsp. paratuberculosis K-10
NCBI Gene ID 2717869
NCBI Protein GI 41407145
Locus Tag MAP1047
Genbank Accession AE016958
Protein Accession NP_959981
Taxonomy ID 262316
Gene Starting Position 1095829
Gene Ending Position 1098195
Gene Strand (Orientation) +
Protein Name RelA
Protein pI 7.63
Protein Weight 79917.73
Protein Length 788
DNA Sequence
>gi|41406098:1095829-1098195 Mycobacterium avium subsp. paratuberculosis K-10, complete genome
CGTGGCGGAGGAAAACAGCGCGGCGCAAGCGCTTGACGCGCCGGCGGAGTCGCCGCCCAACCCGGTGATC
GAGACTCCCGAGCCGCCGACCGAATCGCTCAAGACGTCCAGCAGCGCGTCGCGCCGGGTCCGGGCCCGGC
TGGCCCGGCGGATGACCGCCCAGCGCAGCACGCTCAACCCGGTGCTGGAGCCGCTGGTGGCGATGCACCG
CGAGATCTACCCCAAGGCCAACGTGCAGCTGCTGCAGCGCGCATTCGAGGTCGCCGACCAGCGGCACGCC
AGCCAGTTGCGCCACTCCGGCGACCCCTACATCACCCATCCGCTGGCCGTCGCCACCATCCTGGCCGAAT
TGGGCATGGACACCACCACTTTGGTGGCCGCGCTGTTGCACGACACCGTCGAGGACACCGGCTACACCCT
GGCCCAGCTGTCCGAGGAATTCGGCGAAGAGGTCGGTCATCTGGTCGACGGGGTGACCAAGCTGGACCGG
GTGGTGCTGGGCAGCGCCGCCGAGGGCGAGACCATCCGCAAGATGATCACCGCGATGGCCCGCGACCCGC
GGGTGCTGGTGATCAAGGTCGCCGACCGGCTGCACAACATGCGCACCATGCGGTTCCTGCCGCCGGAGAA
GCAGGCCCGCAAGGCCCGCGAGACGCTGGAAGTCATTGCGCCCCTCGCCCATCGGCTGGGCATGGCCAGC
GTCAAGTGGGAGTTGGAGGACCTGTCGTTCGCCATCCTGCATCCCAAGAAGTACGACGAGATCGTCCGGC
TGGTCGCCGGCCGGGCCCCGTCGCGGGACACCTACCTGGCCAAGGTGCGGGCCGAGATCATCAACACGCT
GAACGCGTCGAAGATCAAGGCGACGGTGGAGGGCCGGCCCAAGCACTACTGGTCGATCTACCAGAAGATG
ATCGTCAAGGGCCGCGACTTCGACGACATCCACGACCTGGTCGGCATCCGCATCCTGTGCGACGAGATCC
GGGACTGCTATGCCGCTGTGGGCGTGGTGCATTCGCTGTGGCAGCCGATGGCCGGGCGGTTCAAGGACTA
CATCGCCCAGCCGCGCTACGGCGTCTACCAGTCGCTGCACACCACCGTCGTCGGGCCGGAGGGCAAGCCG
CTGGAGGTGCAGATCCGCACCCGCGACATGCACCGCACCGCCGAGTACGGCATCGCCGCGCACTGGCGCT
ACAAGGAAGCCAAGGGCCGCAACGGCGTTCCGCACCCGCACGCCGCCGCCGAGATCGACGACATGGCCTG
GATGCGCCAGCTGCTCGACTGGCAGCGGGAAGCCGCCGACCCGGGCGAATTCCTCGAGTCGCTGCGCTAT
GACCTTGCGGTACAAGAGATCTTCGTGTTCACCCCCAAGGGCGACGTGATCACCCTGCCCACCGGGTCGA
CGCCGATCGACTTCGCCTATGCCGTGCACACCGAGGTCGGGCACCGCTGCATCGGCGCCCGGGTCAACGG
CCGGCTGGTGGCGCTGGAACGCAAGCTGGAAAACGGGGAAGTCGTCGAGGTTTTCACCTCCAAGGCGGCC
AACGCGGGCCCGTCGCGGGACTGGCAGCAGTTCGTGGTGTCGCCGCGGGCCAAGGCCAAGATCCGGCAGT
GGTTCGCCAAGGAGCGGCGCGAGGAGGCCCTGGAGGCCGGCAAGGACGCGATGGCCCGCGAGGTGCGCCG
CGGCGGACTTCCGTTGCAGCGCTTGGTCAATGCCGAATCCATGAGCGCGGTGGCCCGCGAACTGCACTAC
GCCGACGTGTCGGCCCTCTACACCGCGATCGGTGAGGGGCATGTGTCGGCCCGGCACGTGGTGCAGCGGC
TGCTGGCCGAGCTCGGCGGCATCGACCAGACCGAGGAGGACCTCGCCGAGCGGTCCACCCCGACCACCAT
GCTGCGCCGCCCGCGCAGCAGCGACGACGTCGGCGTGTCGGTGCCCGGCGCCCCGGGCGTGCTGACCAAG
CTGGCCAAATGCTGCACGCCGGTGCCTGGGGACCAGATCATGGGATTCGTCACCCGCGGCGGCGGGGTGA
GCGTGCACCGCACCGACTGCACCAACGCCGCCTCGCTGCAGCAGCAGTCCGAGCGCATCATCGAGGTGCA
CTGGGCGCCGTCGCCGTCGTCGGTGTTCCTGGTGGCCATTCAGGTCGAGGCGCTCGACCGGCACCGGCTG
TTGTCCGACGTCACCCGGGTGCTGGCCGACGAGAAGGTCAACATCCTGTCCGCGTCGGTCACCACCTCCG
GTGACCGGGTTGCCATCAGCCGCTTCACCTTTGAGATGGGCGACCCCAAGCACCTCGGCCACCTGCTCAA
CGTGGTGCGCAACGTCGAAGGCGTCTACGACGTCTACCGGGTGACCTCCGCCGCCTG
Protein Sequence
>gi|41407145|ref|NP_959981.1| RelA [Mycobacterium avium subsp. paratuberculosis K-10]
MAEENSAAQALDAPAESPPNPVIETPEPPTESLKTSSSASRRVRARLARRMTAQRSTLNPVLEPLVAMHR
EIYPKANVQLLQRAFEVADQRHASQLRHSGDPYITHPLAVATILAELGMDTTTLVAALLHDTVEDTGYTL
AQLSEEFGEEVGHLVDGVTKLDRVVLGSAAEGETIRKMITAMARDPRVLVIKVADRLHNMRTMRFLPPEK
QARKARETLEVIAPLAHRLGMASVKWELEDLSFAILHPKKYDEIVRLVAGRAPSRDTYLAKVRAEIINTL
NASKIKATVEGRPKHYWSIYQKMIVKGRDFDDIHDLVGIRILCDEIRDCYAAVGVVHSLWQPMAGRFKDY
IAQPRYGVYQSLHTTVVGPEGKPLEVQIRTRDMHRTAEYGIAAHWRYKEAKGRNGVPHPHAAAEIDDMAW
MRQLLDWQREAADPGEFLESLRYDLAVQEIFVFTPKGDVITLPTGSTPIDFAYAVHTEVGHRCIGARVNG
RLVALERKLENGEVVEVFTSKAANAGPSRDWQQFVVSPRAKAKIRQWFAKERREEALEAGKDAMAREVRR
GGLPLQRLVNAESMSAVARELHYADVSALYTAIGEGHVSARHVVQRLLAELGGIDQTEEDLAERSTPTTM
LRRPRSSDDVGVSVPGAPGVLTKLAKCCTPVPGDQIMGFVTRGGGVSVHRTDCTNAASLQQQSERIIEVH
WAPSPSSVFLVAIQVEALDRHRLLSDVTRVLADEKVNILSASVTTSGDRVAISRFTFEMGDPKHLGHLLN
VVRNVEGVYDVYRVTSAA
Molecule Role Virmugen
Molecule Role Annotation A M. avium relA mutant is attenuated in calves and goats. This mutant also elicited an immune response in goats that limited colonization by challenge wild type M. avium (Park et al., 2011).
Related Vaccines(s) Mycobacterium avium relA mutant vaccine
References