VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

senB

Gene Name senB
Sequence Strain (Species/Organism) Shigella sonnei Ss046
NCBI Gene ID 3668265
NCBI Protein GI 74313104
Locus Tag SSON_2665
Genbank Accession CP000038
Protein Accession YP_311523
Taxonomy ID 300269
Gene Starting Position 2824138
Gene Ending Position 2825313
Gene Strand (Orientation) +
Protein Name putative enterotoxin
Protein pI 7.25
Protein Weight 41801.28
Protein Length 391
DNA Sequence
>gi|74310614:2824138-2825313 Shigella sonnei Ss046 chromosome, complete genome
AATGAATATTTTCACTTTATCCAAAGCACCGCTATACCTGTTAATTTCACTATTTTTACCCACGATGGCC
ATGGCTATCGATCCACCTGAACGCGAACTTTCGCGATTTGCCCTGAAAACGAATTACCTTCAGTCCCCTG
ATGAAGGCGTCTATGAACTGGCGTTTGATAATGCCAGTAAAAAGGTGTTTGCAGCAGTCACCGATCGTGT
AAATCGTGAAGCCAATAAAGGCTATCTGTATTCGTTTAATTCAGATTCGCTGAAAGTCGAAAATAAATAC
ACGATGCCATACCGGGCATTTTCGCTGGCGATAAATCAGGATAAACATCAGCTCTATATCGGACACACCC
AGTCAGCGTCCCTGCGTATCAGTATGTTTGACACCCCAACCGGCAAACTGGTAAGAACCAGCGACAGGTT
AAGTTTTAAAGCGGCAAACGCTGCAGATTCGCGTTTTGAGCATTTTCGCCATATGGTTTACAGCCAGGAT
TCCGATACCCTGTTTGTGAGTTATAGCAATATGCTGAAAACGGCCGAGGGCATGAAGCCTCTGCATAAGC
TGTTAATGCTCGACGGGACGACGCTTGCCTTAAAAGGCGAGGTTAAGGATGCTTACAAAGGTACAGCGTA
TGGTCTGACGATGGATGAAAAAACACAGAAAATCTACGTTGGCGGAAGAGATTACATCAACGAAATTGAT
GCGAAAAATCAGACGCTGCTGCGTACCATCCCGTTGAAAGATCCGAGACCACAAATCACAAGTGTGCAGA
ATCTGGCGGTGGACTCCGCTTCTGACCGTGCCTTTGTGGTGGTATTCGACCATGACGATCGTTCCGGTAC
AAAAGATGGACTCTATATTTTTGACTTACGCGACGGTAAACAGCTTGGCTATGTGCACACAGGAGCCGGA
GCTAACGCGGTGAAATACAATCCGAAATATAACGAACTGTATGTCACCAACTTCACTAGCGGCACCATCA
GCGTAGTGGATGCCACCAAATACAGCATCACCCGTGAATTTAACATGCCGGTCTACCCAAACCAGATGGT
GTTGTCGGACGATATGGATACCCTTTACATTGGCATCAAAGAAGGCTTTAACCGCGATTGGGATCCTGAT
GTGTTTGTGGAAGGAGCTAAAGAACGTATTCTGAGCATTGATTTGAAAAAGTCGTG
Protein Sequence
>gi|74313104|ref|YP_311523.1| putative enterotoxin [Shigella sonnei Ss046]
MNIFTLSKAPLYLLISLFLPTMAMAIDPPERELSRFALKTNYLQSPDEGVYELAFDNASKKVFAAVTDRV
NREANKGYLYSFNSDSLKVENKYTMPYRAFSLAINQDKHQLYIGHTQSASLRISMFDTPTGKLVRTSDRL
SFKAANAADSRFEHFRHMVYSQDSDTLFVSYSNMLKTAEGMKPLHKLLMLDGTTLALKGEVKDAYKGTAY
GLTMDEKTQKIYVGGRDYINEIDAKNQTLLRTIPLKDPRPQITSVQNLAVDSASDRAFVVVFDHDDRSGT
KDGLYIFDLRDGKQLGYVHTGAGANAVKYNPKYNELYVTNFTSGTISVVDATKYSITREFNMPVYPNQMV
LSDDMDTLYIGIKEGFNRDWDPDVFVEGAKERILSIDLKKS
Molecule Role Virmugen
Molecule Role Annotation A virG, senA, and senB mutant (WRSs2) is attenuated in guinea pigs and induced significant protection from challenge with wild type S. sonnei. Attenuation and protection from WRSs2 is comparable to live attenuated vaccine strain WRSS1 (Barnoy et al., 2010).
Related Vaccines(s) Shigella sonnei virG/senA/senB mutant vaccine , Shigella sonnei virG/senA/senB/msbB2 mutant vaccine
References