VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

msbB2

Gene Name msbB2
Sequence Strain (Species/Organism) Shigella sonnei Ss046
NCBI Gene ID 3670926
NCBI Protein GI 74315019
Locus Tag SSON_P182
Genbank Accession CP000039
Protein Accession YP_313437
Taxonomy ID 300269
Plasmid No pSS_046
Gene Starting Position 159623
Gene Ending Position 160567
Gene Strand (Orientation) +
Protein Name lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase
Protein pI 10.05
Protein Weight 34698.04
Protein Length 314
Protein Note Transfers myristate or laurate, activated on ACP, to the lipid IVA moiety of (KDO)2-(lauroyl)-lipid IVA
DNA Sequence
>gi|74314838:159623-160567 Shigella sonnei Ss046 plasmid pSS_046, complete sequence
AATGAAAAAATACAAATCCGAGTTTATTCCTGAATTTAAGAAAAATTATCTTTCCCCTGTTTACTGGTTT
ACATGGTTCGTTTTGGGAATGATTGCAGGTATTTCAATGTTTCCCCCTTCATTCAGAGATCCTGTCTTGG
CCAAAATAGGGCGTTGGGTGGGCAGATTGAGCAGAAAAGCTCGTCGCAGGGCGACGATTAATTTATCGCT
TTGTTTCCCGGAAAAGAGTGATACAGAACGGGAAATAATTGTCGACAATATGTTTGCCACAGCATTGCAA
TCCATAGTGATGATGGCAGAACTGGCAATTCGTGGTCCGGAAAAGTTCCAGAAACGAGTGTTCTGGAAAG
GCCTCGAAATTCTTGAGGAAATCCGGCACAATAACAGAAATGTGATTTTTCTGGTTCCCCATGGCTGGAG
CGTGGATATTCCTGCAATGTTGCTGGCAGCTCAGGGGGAAAAAATGGCCGCCATGTTTCATCAGCAACGA
AATCCAGTGATTGATTATGTCTGGAATTCTGTACGGCGTAAATTCGGGGGGCGCTTACATTCCCGGGAGG
ATGGGATAAAACCATTTATTCAGTCAGTACGCCAGGGATACTGGGGGTATTACCTTCCAGATCAGGATCA
TGGTCCTGAATACAGTGAATTTGCTGATTTTTTTGCGACCTATAAAGCGACATTACCAATTATTGGACGT
CTGATGAACATCAGTCAGGCTATGATTATACCGCTTTTCCCGGTTTATGATGAAAAAAAACATTTCCTGA
CTATTGAAGTTCGGCCACCAATGGATGCATGCATTGCCAGCGCGGACAATAAAATGATTGCCCGACAAAT
GAACAAAACAGTGGAAATTTTGGTGGGGTCACATCCGGAACAGTATATCTGGGTTTTAAAATTGTTAAAA
ACGCGCAAATCAAACGAAGCGGACCCGTACCCTTG
Protein Sequence
>gi|74315019|ref|YP_313437.1| lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase [Shigella sonnei Ss046]
MKKYKSEFIPEFKKNYLSPVYWFTWFVLGMIAGISMFPPSFRDPVLAKIGRWVGRLSRKARRRATINLSL
CFPEKSDTEREIIVDNMFATALQSIVMMAELAIRGPEKFQKRVFWKGLEILEEIRHNNRNVIFLVPHGWS
VDIPAMLLAAQGEKMAAMFHQQRNPVIDYVWNSVRRKFGGRLHSREDGIKPFIQSVRQGYWGYYLPDQDH
GPEYSEFADFFATYKATLPIIGRLMNISQAMIIPLFPVYDEKKHFLTIEVRPPMDACIASADNKMIARQM
NKTVEILVGSHPEQYIWVLKLLKTRKSNEADPYP
Molecule Role Virmugen
Molecule Role Annotation A virG, senA, senB, and msbB2 mutant (WRSs3) is attenuated in guinea pigs and induced significant protection from challenge with wild type S. sonnei. Attenuation and protection from WRSs3 is comparable to live attenuated vaccine strain WRSS1 (Barnoy et al., 2010).
Related Vaccines(s) Shigella sonnei virG/senA/senB/msbB2 mutant vaccine
References