VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PE2

Gene Name PE2
Sequence Strain (Species/Organism) Western equine encephalomyelitis virus
NCBI Protein GI 90811336
Other Database IDs CDD:109979
CDD:190039
CDD:109978
CDD:144979
Taxonomy ID 11039
Gene Strand (Orientation) ?
Protein Name structural polyprotein
Protein Length 1236
Protein Note Alphavirus core protein; pfam00944
Protein Sequence
>gi|90811336|gb|ABD98014.1| structural polyprotein [Western equine encephalomyelitis virus]
MFPYPQLNFPPVYPTNPMAYRDPNPPRRRWRPFRPPLAAQIEDLRRSIANLTFKQRAPNPPPGPPPKKKK
SAPKPKPTQPKKKKQQAKKTKRKPKPGKRQRMCMKLESDKTFPIMLNGQVNGYACVVGGRLMKPLHVEGK
IDNEQLAAVKLKKASMYDLEYGDVPQNMKSDTLQYTSDKPPGFYNWHHGAVQYENGRFTVPRGVGGKGDS
GRPILDNRGRVVAIVLGGANEGTRTALSVVTWNQKGVTIKDTPEGSEPWSLVTALCVLSNVTFPCDKPPV
CYSLAPERTLDVLEENVDNPNYDTLLENVLKCPSRRPKRSITDDFTLTSPYLGFCPYCRHSAPCFSPIKI
ENVWDESDDGSIRIQVSAQFGYNQAGTADVTKFRYMSYDHDHDIKEDSMEKLAISTSGPCRRLGHKGYFL
LAQCPPGDSVTVSITSGASENSCTVEKKIRRKFVGREEYLFPPVHGKLVKCHVYDHLKETSAGYITMHRP
GPHAYKSYLEEASGEVYIKPPSGKNVTYECKCGDYSTGIVSTRTKMNGCTKAKQCIAYKRDQTKWVFNSP
DLIRHTDHSVQGKLHIPFRLTPTVCPVPLAHTPTVTKWFKGITLHLTATRPTLLTTRKLGLRADATAEWI
TGTTSRNFSVGREGLEYVWGNHEPVRVWAQESAPGDPHGWPHEIIIHYYHRHPVYTVIVLCGVALAILVG
TASSAACIAKARRDCLTPYALAPNATVPTALAVLCCIRPTNAETFGETLNHLWFNNQPFLWAQLCIPLAA
LIILFRCFSCCMPFLLVAGVCLGKVDAFEHATTVPNVPGIPYKALVERAGYAPLNLEITVVSSELTPSTN
KEYVTCKFHTVVPSPQVKCCGSLECKASSKADYTCRVFGGVYPFMWGGAQCFCDSENTQLSEAYVEFAPD
CTIDHAVALKVHTAALKVGLRIVYGNTTARLDTFVNGVTPGSSRDLKVIAGPISAAFSPFDHKVVIRKGL
VYNYDFPEYGAMNPGAFGDIQASSLDATDIVARTDIRLLKPSVKNIHVPYTQAVSGYEMWKNNSGRPLQE
TAPFGCKIEVEPLRATNCAYGHIPISIDIPDAAFVRSSESPTILEVSCTVADCIYSADFGGSLTLQYKAN
REGHCPVHSHSTTAVLKEATTHVTATGSITLHFSTSSPQANFIVSLCGKKTTCNAECKPPADHIIGEPHK
VDQEFQAAVSKTSWNWLLALFGGASSLIVVGLIVLVCSSMLINTRR
Molecule Role Virmugen
Molecule Role Annotation A PE2 mutant combined with either a deletion in E2 (WE2102) or E1 (WE2130) induced low-level viremia in chickens and protected against challenge with wild type WEE after 2 weeks. This study also found that it is unlikely that mosquito transmission of these two strains would occur (Turell et al., 2003).
Related Vaccines(s) Western equine encephalomyelitis virus PE2/E1 mutant vaccine , Western equine encephalomyelitis virus PE2/E2 mutant virus
References