VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

mucR

Gene Name mucR
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
NCBI Gene ID 1197075
NCBI Protein GI 17987647
Locus Tag BMEI1364
Genbank Accession AE008917
Protein Accession NP_540281
Taxonomy ID 224914
Chromosome No I
Gene Starting Position 1417768
Gene Ending Position 1418253
Gene Strand (Orientation) -
Protein Name transcriptional regulatory protein MUCR
Protein pI 9.56
Protein Weight 16771.01
Protein Length 161
DNA Sequence
>gi|17986284:1417768-1418253 Brucella melitensis bv. 1 str. 16M chromosome chromosome I, complete sequence
ATCAGGCGTCCTTCGGCTTGCGGCCGAGGCCCATCTTCTTGGCAAGGCGCGAGCGCGCTGCAGCATAGTT
CGGAGCAACCATAGGATAGTTCGGATCGAGATCCCACTTTTCGCGGTACTGCTCAGGCGTCATGTTGTAA
TGGGTCACCAGGTGACGCTTCAGCGACTTGAACTTCTTGCCGTCTTCAAGGCAGACAATATAGTCGTCAT
GAACAGACTTCTTCGGGTTCACCGCTGGCTTCGGCTTTTCAACAACGACCGGGGCCTCTTCGCGTTCGAC
GTGGCGCTTGAAAGCAGCATGAACTTCAGCAATCAGAACCGGGAGTTCGCCTGCACGAATGGAATTATTG
CCGACATAGGCTGCAACGACATCGGCGGTCAAACTCAAAAGCAGCTCGGTGCTTTCGTCGTTCGTTTCCA
GATTTTCCATAAGTTTTCCTTTTTTAATTTTTTGTTGTCCGCGCAGCGGCTGACAATGGCAACCCA
Protein Sequence
>gi|17987647|ref|NP_540281.1| transcriptional regulatory protein MUCR [Brucella melitensis bv. 1 str. 16M]
MGCHCQPLRGQQKIKKGKLMENLETNDESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHV
EREEAPVVVEKPKPAVNPKKSVHDDYIVCLEDGKKFKSLKRHLVTHYNMTPEQYREKWDLDPNYPMVAPN
YAAARSRLAKKMGLGRKPKDA
Molecule Role Virmugen
Molecule Role Annotation A mucR mutant has a significantly reduced degree of colonization in mice and protects against wild type B. melitensis 16M (Arenas-Gamboa et al., 2011).
Related Vaccines(s) Brucella melitensis mucR mutant vaccine
References