VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

guaA from S. typhimurium str. LT2

Gene Name guaA from S. typhimurium str. LT2
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI Gene ID 1254032
NCBI Protein GI 16765830
Locus Tag STM2510
Genbank Accession AE006468
Protein Accession NP_461445
Taxonomy ID 700720
Gene Starting Position 2622804
Gene Ending Position 2624381
Gene Strand (Orientation) -
Protein Name GMP synthase
Protein pI 5.06
Protein Weight 53458.79
Protein Length 525
Protein Note contains glutamine-hydrolyzing domain and glutamine amidotransferase; GMP-binding domain; functions to produce GMP from XMP in the IMP pathway
DNA Sequence
>gi|16763390:2622804-2624381 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
CTTATTCCCACTCAATGGTAGCCGGCGGTTTACCGCTGATGTCATACACCACACGGGAAATCCCGTTGAC
TTCATTGATGATGCGGTTGGAAACGCGACCGAGGAAGTCATACGGCAGGTGCGCCCAGTGTGCGGTCATA
AAGTCGATGGTTTCGACGGCACGCAGAGAGACAACCCAGTCATACTTACGACCATCGCCCATAACGCCAA
CGGAACGAACCGGCAGGAAGACGGTAAACGCCTGACTGACTTTGTCGTACAGATCCGCTTTGCGCAGCTC
TTCAATGAAGATAGCGTCAGCACGGCGCAGCAGGTCGCAGTACTCTTTCTTCACTTCACCCAGAACACGA
ACGCCGAGGCCCGGCCCCGGGAACGGATGGCGATACAGCATGTCATACGGCAGGCCCAGCTCCAGACCAA
TCTTACGCACTTCGTCTTTGAACAGCTCTTTCAGCGGTTCAACCAGCCCCATCTTCATCTCTTTCGGCAA
GCCGCCGACATTGTGGTGAGATTTGATGACGTGCGCTTTACCGGTTGCAGACGCCGCAGATTCGATAACG
TCAGGGTAAATGGTGCCTTGCGCCAGCCACTTCACGTCTTCCAGTTTGAGCGCTTCTTCGTCGAACACTT
CTACAAAAACACGACCGATGATCTTACGCTTGGCTTCCGGATCGTTCTCGCCAGCCAGCGCGGACAGGAA
GCGCTCTTCTGCCGGTACGTGAACGATATTCAGGCCAAAATGGTCGCCAAACATGTCCATCACCTGCTCG
GCTTCGTTGAGACGCAGCAGGCCGTTGTCGACGAATACACAGGTCAGATTTTTACCGATCGCGCGGTGCA
GCAGCATTGCGGTGACGGAAGAATCCACGCCACCAGAGAGGCCGAGGATCACTTTGTCGTCGCCCACCTG
CTCGCGAATGCGCGCCACGGCGTCGTCGATGATCTTCGCCGGCGTCCACAACGCTTCACACTGGCAGATA
TCGCGTACAAAACGCTCCAGCATGCGCATACCCTGGCGGGTGTGAGTCACTTCCGGGTGGAACTGTACAC
CGTAGAAGCGTTTTTCTTCGTTGGCCATAATGGCGAACGGGCAGCTCTCGGTGCTGGCGACGGTCACGAA
GTCGGACGGAATCGCCGTCACTTTATCGCCGTGGCTCATCCACACGTCCAGCAGCGGTTTGCCGTCTGCG
GTCAGGGAATCTTCAATACCGCGAACCAGCGCGCTGTCGGTCAACACTTCGACCTGCGCATAACCAAATT
CACGCTCATTAGAACCTTCTACATGACCGCCAAGCTGCATCGCCATGGTCTGCATACCATAGCAAACGCC
AAATACCGGCACGCCTGCTTCAAAGACATACTGCAGCGCGCGCGGGCTGTTTTCTTCGGTGGTGCTTTCC
GGGCCGCCGGAAAGAATAATGCCGCTTGGGTTGAAGTCACGAATTTGTGCTTCTGTCACATCCCACGCCC
ACAGTTCACAGTAAACACCCAGCTCACGCACGCGGCGCGCAACCAGTTGAGTGTACTGAGAACCGAAGTC
CAGAATGAGGATGCGATGCTTATGAATGTTTTCCGTCA
Protein Sequence
>gi|16765830|ref|NP_461445.1| GMP synthase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MTENIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPR
ALQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVLTDSALVRGIEDSLTADGKPLLDVW
MSHGDKVTAIPSDFVTVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTP
AKIIDDAVARIREQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVMDMFGDH
FGLNIVHVPAEERFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATG
KAHVIKSHHNVGGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEY
CDLLRRADAIFIEELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPY
DFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE
Molecule Role Virmugen
Molecule Role Annotation A guaBA and clpP mutant (CVD 1921) of Salmonella Typhimurium is attenuated in mice after oral immunization. The mutant was also protective, rendering a vaccine efficacy of 86% in mice against challenge with wild type Salmonella Typhimurium (Tennant et al., 2011).
Related Vaccines(s) Salmonella Typhimurium guaBA/clpP mutant vaccine , Salmonella Typhimurium guaBA/clpP/fliD mutant vaccine
References