VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

guaB

Gene Name guaB
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI Gene ID 1254033
NCBI Protein GI 16765831
Locus Tag STM2511
Genbank Accession AE006468
Protein Accession NP_461446
Taxonomy ID 700720
Gene Starting Position 2624451
Gene Ending Position 2625917
Gene Strand (Orientation) -
Protein Name inosine 5'-monophosphate dehydrogenase
Protein pI 6.59
Protein Weight 47186.87
Protein Length 488
Protein Note catalyzes the synthesis of xanthosine monophosphate by the NAD+ dependent oxidation of inosine monophosphate
DNA Sequence
>gi|16763390:2624451-2625917 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
ATCAGGAGCCCAGACGGTAGTTCGGGGACTCTTTGGTGATGGTCACGTCGTGAACGTGGCTTTCCTGAAT
GCCCGCACCGCTGATACGCACAAACTCCGCTTTAGTACGCAGTTCGTCGATGGTAGCACAACCGGTCAGC
CCCATACAGGAGCGCAGGCCGCCCATCTGCTGGTGAATGATCTCTTTCAGGCGACCTTTATAGGCTACGC
GACCTTCGATACCTTCCGGCACCAGTTTGTCAGCGGCGTTGTCGCTCTGGAAGTAACGGTCGGAGGAACC
TTTGGACATCGCACCCAGCGAGCCCATGCCGCGGTAAGATTTGTAAGAACGGCCCTGGTAGAGTTCGATT
TCGCCCGGGGATTCTTCCGTACCCGCCAGCATGGAACCCACCATTACCGCGCTTGCACCTGCGGCAATCG
CTTTGGCTATGTCGCCGGAGAAACGGATACCGCCGTCAGCGATAACCGGAATACCGGTACCTTCCAGCGC
TTCAACTGCGTCAGAAACAGCGGTGATCTGCGGAACGCCCACGCCAGTCACGATACGAGTGGTACAGATG
GAACCCGGGCCAATACCGACTTTCACCGCGCTGCAACCGGCTTCCGCCAGTGCGCGAGCGCCTGCGCCTG
TCGCGACGTTGCCGCCGATGATTTGCAGGTCAGGATATTTAGCACGGGTTTCACGGATACGTTGCAACAC
GCCTTCTGAATGACCGTGAGAGGAGTCGATCAGCAGTACGTCAACGCCTGCCGCCACCAGCGCGTCAACG
CGCTCTTCGTTGCCCGCGCCTGCGCCGACCGCCGCGCCGACACGTAAACGGCCCTGCTCATCTTTGCAGG
AGTTTGGTTTACGTTCCGCTTTCTGGAAATCTTTTACGGTAATCATGCCAAGCAGATGGAAGTTATCATC
AACGACCAGCGCTTTTTCTACGCGTTTTTCGTGCATTTTTGCCAGCACGACTTCACGGGCTTCGCCTTCA
CGAACGGTCACCAGACGCTCTTTCGGCGTCATGTAAACGCTAACCGGCTGGTTCAGGTCAGTCACAAAAC
GCACGTCACGACCGGTGATGATACCCACCAGCTCGTTATCTTCAGTCACCACCGGATAGCCCGCAAAACC
GTTACGCTCGGTCAGGGCTTTCACTTCATGCAACGTGGTGGTTGGCAGGACGGTCTGCGGGTCGGTCACT
ACGCCGGACTCGTGTTTCTTCACGCGGCGAACTTCTTCCGCCTGGCGCTCAATGGACATGTTTTTGTGGA
TAAAACCAATGCCGCCTTCCTGGGCCAGGGCAATTGCCAGGCGCGCTTCCGTCACGGTGTCCATCGCCGC
AGAAAGCATAGGAATATTCAGACGAATAGTTTTCGTCAACTGCGTGCTGAGATCGGCAGTATTCGGCAAA
ACGGTGGAGTGAGCGGGAACAAGGAGGACGTCGTCAAACGTCAGGGCTTCTTTAGCGATACGTAGCA
Protein Sequence
>gi|16765831|ref|NP_461446.1| inosine 5'-monophosphate dehydrogenase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFI
HKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLHEVKALTERNGFAGYPVVTEDNELVGIITGRDVR
FVTDLNQPVSVYMTPKERLVTVREGEAREVVLAKMHEKRVEKALVVDDNFHLLGMITVKDFQKAERKPNS
CKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVAT
GAGARALAEAGCSAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVEALEGTGIPVIADGGIRFSGDIAKA
IAAGASAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIEGR
VAYKGRLKEIIHQQMGGLRSCMGLTGCATIDELRTKAEFVRISGAGIQESHVHDVTITKESPNYRLGS
Molecule Role Virmugen
Molecule Role Annotation A guaBA and clpP mutant (CVD 1921) of Salmonella Typhimurium is attenuated in mice after oral immunization. The mutant was also protective, rendering a vaccine efficacy of 86% in mice against challenge with wild type Salmonella Typhimurium (Tennant et al., 2011).
Related Vaccines(s) Salmonella Typhimurium guaBA/clpP mutant vaccine , Salmonella Typhimurium guaBA/clpP/fliD mutant vaccine
References