VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fliD

Gene Name fliD
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI Gene ID 1253481
NCBI Protein GI 16765298
Locus Tag STM1960
Genbank Accession AE006468
Protein Accession NP_460913
Taxonomy ID 700720
Gene Starting Position 2049401
Gene Ending Position 2050804
Gene Strand (Orientation) +
Protein Name flagellar capping protein
Protein pI 5.02
Protein Weight 47254.05
Protein Length 467
Protein Note involved in flagellin assembly
DNA Sequence
>gi|16763390:2049401-2050804 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
CATGGCTTCAATTTCATCATTAGGTGTGGGATCAAACTTACCGTTAGACCAGTTGTTGACAGACCTGACA
AAGAACGAAAAAGGACGCTTAACGCCAATTACCAAACAGCAGAGCGCGAATTCGGCAAAGCTAACCGCCT
ATGGCACATTGAAAAGCGCATTAGAAAAATTCCAGACGGCAAATACCGCGTTAAATAAAGCGGATTTATT
TAAGTCTACCGTGGCGTCCAGCACCACTGAAGATCTCAAAGTCAGTACTACCGCTGGCGCTGCCGCAGGG
ACTTATAAGATTAACGTAACCCAGCTTGCCGCCGCACAGTCGCTGGCGACAAAAACCACCTTCGCGACCA
CCAAAGAGCAGTTGGGCGATACGTCGGTCACGTCCCGGACAATTAAAATTGAACAGCCGGGACGTAAAGA
GCCGCTGGAAATTAAGCTGGATAAAGGCGACACCTCCATGGAGGCGATCCGTGACGCCATCAATGACGCC
GACAGCGGTATCGCCGCCAGTATCGTTAAGGTCAAAGAGAACGAATTCCAGTTGGTGCTTACCGCCAATA
GCGGTACCGACAATACGATGAAGATCACGGTGGAAGGCGATACAAAACTTAACGATCTACTCGCTTATGA
CAGCACCACCAATACCGGCAATATGCAAGAGCTGGTGAAAGCAGAAAACGCGAAGCTGAACGTAAACGGC
ATCGACATTGAGCGTCAGAGCAATACCGTAACCGACGCCCCTCAGGGAATTACGCTCACCCTGACCAAGA
AAGTGACCGACGCGACCGTGACGGTAACGAAAGATGATACCAAGGCGAAAGAGGCGATTAAATCCTGGGT
GGATGCCTATAACTCGCTGGTGGATACCTTTAGCTCGTTAACCAAATATACCGCCGTTGAGCCGGGCGAA
GAAGCCAGCGATAAAAACGGCGCGCTGTTAGGCGATAGTGTGGTTCGTACTATCCAGACCGGGATTCGGG
CACAATTTGCCAATAGCGGCAGTAATTCTGCGTTCAAAACAATGGCGGAAATTGGCATCACCCAGGATGG
GACTTCCGGCAAACTGAAGATTGATGATGATAAGCTGACCAAAGTACTGAAAGATAACACAGCCGCAGCG
CGTGAGCTGCTGGTAGGCGATGGTAAAGAAACGGGTATCACCACCAAAATTGCCACCGAAGTGAAAAGTT
ATCTGGCGGATGACGGCATTATTGATAATGCGCAGGACAACGTTAACGCCACGCTGAAAAGCCTGACAAA
ACAGTACCTGTCCGTTAGCAACAGCATCGATGAAACCGTTGCCCGTTACAAGGCCCAGTTTACCCAACTG
GATACCATGATGAGTAAGCTGAATAACACCAGTAGTTATTTGACCCAGCAATTTACAGCTATGAACAAGT
CCTG
Protein Sequence
>gi|16765298|ref|NP_460913.1| flagellar capping protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MASISSLGVGSNLPLDQLLTDLTKNEKGRLTPITKQQSANSAKLTAYGTLKSALEKFQTANTALNKADLF
KSTVASSTTEDLKVSTTAGAAAGTYKINVTQLAAAQSLATKTTFATTKEQLGDTSVTSRTIKIEQPGRKE
PLEIKLDKGDTSMEAIRDAINDADSGIAASIVKVKENEFQLVLTANSGTDNTMKITVEGDTKLNDLLAYD
STTNTGNMQELVKAENAKLNVNGIDIERQSNTVTDAPQGITLTLTKKVTDATVTVTKDDTKAKEAIKSWV
DAYNSLVDTFSSLTKYTAVEPGEEASDKNGALLGDSVVRTIQTGIRAQFANSGSNSAFKTMAEIGITQDG
TSGKLKIDDDKLTKVLKDNTAAARELLVGDGKETGITTKIATEVKSYLADDGIIDNAQDNVNATLKSLTK
QYLSVSNSIDETVARYKAQFTQLDTMMSKLNNTSSYLTQQFTAMNKS
Molecule Role Virmugen
Molecule Role Annotation A guaBA, clpP, and fliD mutant (CVD 1923) is attenuated in mice after oral immunization. This mutant is also protective, with a vaccine efficacy of 80% in mice against wild type challenge from Salmonella Typhimurium (Tennant et al., 2011).
Related Vaccines(s) Salmonella Typhimurium guaBA/clpP/fliD mutant vaccine
References