VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

clpP

Gene Name clpP
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NCBI Gene ID 6950532
NCBI Protein GI 207855928
Locus Tag SEN0430
Genbank Accession AM933172
Protein Accession YP_002242579
Taxonomy ID 550537
Gene Starting Position 482579
Gene Ending Position 483202
Gene Strand (Orientation) ?
Protein Name ATP-dependent Clp protease proteolytic subunit
Protein pI 5.88
Protein Weight 22084.77
Protein Length 207
Protein Note hydrolyzes proteins to small peptides; with the ATPase subunits ClpA or ClpX, ClpP degrades specific substrates
DNA Sequence
>gi|207855516:482579-483202 Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 chromosome, complete genome
AATGTCATACAGCGGAGAACGAGATAATTTGGCCCCTCATATGGCGCTGGTGCCGATGGTCATTGAACAG
ACCTCACGCGGTGAGCGCTCTTTTGATATCTATTCTCGTCTACTTAAGGAACGCGTCATATTTCTGACCG
GCCAGGTCGAAGACCATATGGCTAACCTGATCGTGGCGCAGATGCTGTTCCTGGAAGCGGAAAACCCGGA
AAAAGATATCTATCTGTACATTAATTCTCCTGGCGGCGTAATTACTGCGGGGATGTCCATCTATGACACC
ATGCAGTTTATTAAGCCAGACGTCAGCACCATTTGTATGGGACAGGCGGCCTCTATGGGGGCGTTTCTGC
TGACTGCCGGGGCGAAAGGCAAACGTTTCTGCTTGCCGAACTCTCGCGTCATGATCCACCAGCCGCTGGG
CGGCTACCAGGGCCAGGCGACGGATATTGAAATTCACGCCCGCGAAATTTTGAAAGTAAAAGGGCGCATG
AATGAACTTATGGCGCATCATACGGGTCAATCTCTTGAGCAGATTGAACGTGATACTGAGCGCGATCGCT
TCCTCTCCGCGCCTGAAGCGGTAGAGTACGGTTTGGTTGACTCAATTTTGACCCATCGTAATTG
Protein Sequence
>gi|207855928|ref|YP_002242579.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPE
KDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLG
GYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN
Molecule Role Virmugen
Molecule Role Annotation A guaBA and clpP mutant (CVD 1941) is attenuated in mice after oral immunization. This mutant is also protective, and had a vaccine efficacy of 76% against challenge with wild type Salmonella Enteritidis (Tennant et al., 2011).
Related Vaccines(s) Salmonella Enteritidis guaBA/clpP mutant vaccine
References