VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

aroC

Gene Name aroC
Sequence Strain (Species/Organism) Edwardsiella tarda EIB202
NCBI Gene ID 8608790
NCBI Protein GI 269139790
Locus Tag ETAE_2445
Genbank Accession CP001135
Protein Accession YP_003296491
Taxonomy ID 498217
Gene Starting Position 2576311
Gene Ending Position 2577396
Gene Strand (Orientation) -
Protein Name chorismate synthase
Protein pI 6.99
Protein Weight 36170.26
Protein Length 361
DNA Sequence
>gi|269137358:2576311-2577396 Edwardsiella tarda EIB202 chromosome, complete genome
TTTACCAGCGCGGTATCGTACAGGCGACATCCGCACACTGCGCACGCTGGCGCAGCAAATGATCCATCAG
CACCAGCGCCATCATCGCCTCGGCGATCGGCACCGCCCGGATCCCCACGCAGGGATCGTGGCGGCCGCGG
GTGACCATGGTCGTCGCCTCGCCGTCGCGGGTAATGGTCTGCCCCGGCACCATAATGCTCGACGTCGGCT
TCAGCGCCAGACGCGCCAGCAGCGGCTGACCGCTGCTGATCCCGCCCAGAATGCCGCCGGCATGGTTGCT
GAGAAAGCCCGTCGGGCTGATCTCGTCACGGTGCTCGCTGCCGCGCTGCCCCACCACCGCAAAGCCGTCG
CCGATCTCGACGCCCTTCACCGCATTGATGCTCATCAGCGCATGGGCCACGTCGGCATCCAGGCGATCGA
AGACCGGCTCGCCCAGCCCGGGGGGAACCCCGGTCGCCATCACCATCACCTCGGCGCCGATCGAGTCGCC
GCTCTTTTTCAGATCGCGCATCAGGGCATCCAGCGCCGCCAGCTGCTGGACATCGGGACAGAAGAAGGGA
TTCTGCTCTACCTGCGCCCAGTCATACTGACGGCAGACGATATCGCCCATCCGGCTCAGGCAGGCGCGGA
TAACGATGCCATGCTGCTGCTGAAGGTATTTTTTCGCGATCGCCCCGGCGGCGACGCGCATCGCGGTCTC
CCGCGCAGAGGAGCGCCCGCCGCCGCGGTAGTCGCGCAGACCATACTTCTGCTCATAGCTGTAGTCAGCG
TGACCCGGACGAAACAGATCCTTGATGGCGCTATAGTCCTGCGAGCGCTGATCGGTGTTCTCGATCAGCA
GTCCAATACTGGTGCCGGTGGTCACCCCCTCAAAGACACCCGACAGGATCCGCACCCGATCATCCTCTCG
CCGCGCCGTGGTGTAGCGCGATGCGCCGGGGCGACGGCGATCGAGATCGTGCTGCAGATCCGCCTCGCTC
AGCGCCATTCCCGGCGGAACGCCGTCCACAATGCAGCCCAGCGCCGCACCGTGTGACTCGCCGAAGGTGG
TGACTCTGAATACCTGACCAATGCTGTTTCCCGCCA
Protein Sequence
>gi|269139790|ref|YP_003296491.1| chorismate synthase [Edwardsiella tarda EIB202]
MAGNSIGQVFRVTTFGESHGAALGCIVDGVPPGMALSEADLQHDLDRRRPGASRYTTARREDDRVRILSG
VFEGVTTGTSIGLLIENTDQRSQDYSAIKDLFRPGHADYSYEQKYGLRDYRGGGRSSARETAMRVAAGAI
AKKYLQQQHGIVIRACLSRMGDIVCRQYDWAQVEQNPFFCPDVQQLAALDALMRDLKKSGDSIGAEVMVM
ATGVPPGLGEPVFDRLDADVAHALMSINAVKGVEIGDGFAVVGQRGSEHRDEISPTGFLSNHAGGILGGI
SSGQPLLARLALKPTSSIMVPGQTITRDGEATTMVTRGRHDPCVGIRAVPIAEAMMALVLMDHLLRQRAQ
CADVACTIPRW
Molecule Role Virmugen
Molecule Role Annotation An aroC mutant is attenuated in zebra fish. The aroC mutant is also protective against challenge with wild type E. tarda and has a relative percent survival of 68.3% (Xiao et al., 2011).
Related Vaccines(s) Edwardsiella tarda aroC mutant vaccine , Edwardsiella tarda aroC/esrC mutant vaccine
References