VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GPX1

Gene Name GPX1
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 2876
NCBI Protein GI 41406084
Genbank Accession AC121247
Protein Accession NP_000572
Taxonomy ID 9606
Chromosome No 3
Gene Starting Position 49394608
Gene Ending Position 49395790
Gene Strand (Orientation) -
Protein Name transcript variant 1
Protein pI 6.51
Protein Weight 20647.83
Protein Length 203
Protein Note Also known as GPXD; GSHPX1
DNA Sequence
>gi|224589815:49394608-49395790 Homo sapiens chromosome 3, GRCh37.p5 Primary Assembly
GTTCTGCTGACACCCGGCACTTTATTAGTGGGGAAACTCGCCTTGGTCTGGCAGAGACTGGGATCAACAG
GACCAGCACCCATCTCGAGGTGGTATTTTCTGTAAGATCAGGTGTTCCTCCCTCGTAGGTTTAGAGGAAA
CACCCTCATAGATGAAAACCCCCCCGAGACAGCAGCACTGCAACTGCCAAGCAGCCGGGGTAGGAGGGGC
GCCCTAGGCACAGCTGGGCCCTTGAGACAGCAGGGCTTCGATGTCAGGCTCGATGTCAATGGTCTGGAAG
CGGCGGCTGTACCTGCGTAGGGGCACACCGTCAGGGCCCACCAGGAACTTCTCAAAGTTCCAGGCAACAT
CGTTGCGACACACCGGAGACCAGGTGATGAGCTTGGGGTCGGTCATAAGCGCGGTGGCGTCGTCGCTGGG
AGCTGGCAGGGCCTCCCGCAGGAAGGCGAAGAGAGGGTGCGCCCCCGCACCGTTCACCTCGCACTTCTCG
AAGAGCATGAAGTTGGGCTCGAACCCACCACCAGGCCGGACGTACTTGAGGGAATTCAGAATCTCTTCGT
TCTTGGCGTTCTCCTACAGGAGAGAAGGGCAGCTAGAACCCGGGGTCAAGAGGAGGAGAGAAACGTTCTA
ACCACAAACAAGGGAGATTTTCTATGAGTCACCGGGATTTTGCCCTCCATGCGCAATCCCAAGGGCGGAG
AGGAATTTCAGCAGCTACGAGCAACAGAAAGGAAACGAGAGAGTAGCCAGACTCTCCGCGCATGGAGCCG
ACGGCACCCACCAGCACACCGCCGGCGCCCCCAGCCACTACTGCACGTCCGCCCCCGCCCCGCCCCGCTC
CGCCCGGCGCACCTGATGCCCAAACTGGTTGCACGGGAAGCCGAGCACCACCAGGCCCCGGGGTCCGAGG
CGCCGCTGCAGCTCGTTCATCTGGGTGTAGTCCCGGACCGTGGTGCCTCAGAGGGACGCCACATTCTCGA
TAAGTAGTACCTTGCCCCGCAGGGAGCCCAGGCTCACAGGCTCCCCGCCGGCCAGCGGGCGCGCCGAGAA
GGCATACACCGACTGGGCCGCCGCCGCCGCCGCCGCTAGCCGAGCAGCACACATGGCGCAATTGTCCAAG
AAGCCAGCGGAGCGCCCCGAACAAGCACTGTAAGGGGAGGCCAGCAGGCGCCTCCTTTTAACT
Protein Sequence
>gi|41406084|ref|NP_000572.2| glutathione peroxidase 1 isoform 1 [Homo sapiens]
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRG
LVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDA
TALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Molecule Role Vaximmutor
Related Vaccines(s) Bacille Calmette-Guérin (BCG)
References