VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

TLR1

Gene Name TLR1
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 7096
NCBI Protein GI 41350337
Genbank Accession AC108044
Protein Accession NP_003254
Taxonomy ID 9606
Chromosome No 4
Gene Starting Position 38797875
Gene Ending Position 38806411
Gene Strand (Orientation) -
Protein Name toll-like receptor 1
Protein pI 7.07
Protein Weight 86022.3
Protein Length 786
Protein Note Also known as TIL; CD281; rsc786; TIL. LPRS5
DNA Sequence
>gi|224589816:38797875-38806411 Homo sapiens chromosome 4, GRCh37.p5 Primary Assembly
CTTATGTGTCAGAACTGTTTAAATCAAAGTTATATCATTTCATTAATTTTTAATACCACATATAAATGGT
GAACTGCGACCCGAAGGTATATATTTTTACCTACATCATACACTCACAATTGTGTTTACATCTATGCTGA
TGCAAAATAAAGTCATTGTTGGAACTTCCAAAAGCAGCAATATCAACAGGAGGAATATTTTTCACTTGAT
GTGTAATCTATTTCTTTGCTTGCTCTGTCAGCTTAATATTAATGGCTGCCCTTAAGTTAGCCCAAAAAAG
GCCACGTTTGCTCTTTTCCTTGGGCCATTCCAAATAAGTCCTCCTGGCCATGAGACTTTTGAGCTTGTGA
TAACTGCTAGGAATGGAGTACTGCGGAATGGGTTCCAGCAAGATCAGGATTAAGCTATTAGATCCTTCAT
GAAAGAGATTGTGATGGGCAAAGTAGAGTTCATAATGGCACCATTCACTCTGGACAAAGTTGGGAGACAA
AACAAAGATGGACTTGTAACTCTTCTCAATGCAGGTGATGATATTTTCCACAATGCTCTTGCCAGGAACA
AAGTTTCTCTCATGAAGGCAAATCTGCATACCTTCTTTCTCTAGGTTTGGCAATAATTCATTCTTCACCC
AGAAAGAATCGTGCCCACTATATGAAATAAATGCATGAAACTGGAGATTTCTTTGGAGTTCTTCTAAGGG
TATGTTCCTGGCCCTGCGCCGGGTCTGGGTCCACTGGCACACCATCCTGAGATACCAGGGCAGATCCAAG
TAGCTGCAGAGGGAGGTCACAGTCACAGCCAACACCAGCATGGTGGCAACGATGGTGACGATCAGCAGAG
TTATGTTGCAGGATAATTCAGACATGTGAAAGTCCTTTAGTAGGGTTCCTCTATAACTTTCCGGGTAGTC
ACACTTATAAGAATCAGGCCAGCCCTCTAACACTTCACTTGATACTTGGTCTATATTTTTGACAAATTCT
CCTAGCTCACAGGTACATTGGAATGGATTGTCCCCTGCTTTTATTGACCTCATCTTCTGGCAGCTCTGGA
AGAAATCAGCCGATGGGTGGGAAACTGAATTGTGATCAATGATCAATACAGAAAGGCTGCTAAAGCTGCC
ACATCCAGGAAGGTCAGTTAAAGAATTGAAAGCAACATTGAGTTCTTGCAAAGCTTCCAGTTTTACGACT
TGTTTAGGAATGCTCTTTATTTTATTGCTGTGAAGATCAAGTACCTTGATCCTGGGAGGTAAACATCTGA
AAATAGTGTCAGTAAGTATATTTGAAGACATATTTAAACTTAATAAACTTTTAGTCCAAGAACAGTCTCC
TTTCTTTTCATCATAGCTTACAGAATTCTGGCTAATATCCAATTGTTGCAGAGACTTCATCTGTGTAGTC
ATTTCAGCTATTTTTGAAAGTTCTTTTAATTGATTCATTTGTAAAATAAGTGTCTCCAACTCAGTAAGGT
GCCCACAATTTTCAAAAACCGTGTCTGTTAAGAGATTATTGGAAAAATCCAAATGCAGGAACGGGCTAAT
TTTGGATGGGCAAAGCATGTGGACCATGCGTGTACCAGACACTGTGAAATTTTTGATGTTCATATTCGAA
AAGATTTCATAGATATAACTTTGCGGAAAACCGAACACATCGCTGACAACTTGGTGTATAGACAAGGCCT
TCAAGGAAGTGCCAGAATAATCAAAATCTCTGAAGTCCAGCTGACCCTGTAGCTTCACGTTTGAAATTGA
GAAATACCATACAGTTGTATGCCAAACCAGCTGGAGGATCCTAATGAAAGAATTCCAAGTTGTTTCAATG
TTGTTTAAGGTAAGATTTGATAACTTTGGATTTGTTTGAAGTTTCGCCAGAATACTTAGGAAGTAAGAAC
ATTTGTTATCTTCTAGCACACATTTGATATTAGATAGTTCCAGATTTGCTACAGTCTTGACTGACACATC
CAAAATAAAATGGAATTCTTTGTTTGTGGGGAACACAATGTGCAGACTCTCAGTGTTAAAGTCTTGAAGG
CCCTCAGGGTCTTCTTTTTCCCCATAAGTCTCTCCTAAGACCAGCAAGACCTTGCTGATATTCAAATGAG
CAATTGGCAGCACACTAGATTTTTCTAAGTGTGTGGTGCTCAACCCCAGAAATTTTAGTTGAGACATATT
GCCAAACTCTTTGCATATAGGCAGGGCATCAAATGCATTAAATGACAGGTCCAAGTGCTTGAGGTTCACA
GTAGGGTGGCAAGAAATCTTCACCAACTTGTTGTGGGACAAATCCAAGTATTCCAATTCCTGGTTGAATT
TGAAAACACTGATATCAAGATACTGGATTCTATTATGAGAAATTATCAAAATCCTCAGTTTTGACAGTGA
TAAGATGTCAGAAGTCCAAAGCTCAGATATATAATTTTGCGATATATTTAAGATTGTTGTTTTCTGGGAT
AGGTCTTTAGGAACGTGGATGAGACCGTTTTTTGACCTATCAACTAAAAATTCACTTTCTTCAGATAATT
GTATTCTGATCTGAAGTATTAACATGAAGATAATGGCAAAATGGAAGATGCTAGTCATTTTGGAACACTA
GACATTCCTAAAGGTAGAAGCTGTTCTTCAGATCATCTTGATACAGATACAGATTCTAGAAAAAAAATAA
TGAAATGATGAAATACATTACATACATTTTTAAAATACACGAAATTAGTCATGGCTGACATTAAACTTTT
TTTTGTTACAGACTTATAAAGTGGAGGCTACATTCTTTTGGGTTACATGGCCTAAAACTAGAGAAGTATA
TATATTGGTAAATAATGATGCCAGCTCTAATCAAATAAGTTTTAATATGGATGGTGTAATAGGTTGAATG
GTGGCTCACCAAAAGATATGTCTACATCTTAACCATGTCCTAATCCCCAGAAACCATGAATGTTACCTTC
CTTAGAAAAGGGGTCTTTGCAGAGATAATAAAGTTAAGGATCTTGAGATGAGGAGATCATCCCAAATTAT
CCAGGTGGTCCATAAATCCAATGACAAGTGCTTTTTTAAGAGAAAGGCAGAGGGATATTTGACAAAGAGA
CAAGAGAAGAGGCAATTGAGACACAGAGGAGAAGGCCTTGTGACAGTGGAGGCAGAGACTGGAGTGCAGC
AGCTACAAGGCAAGGAACATCAACAGGCGCCAGAAGCTAGAGGAGGCTCTGGAGTGATGGTGGCCCTGCT
GACACCTTGAGTTTCGACTTCTGCTCTCCAGAACGTTGAGGGCAAAGCCACCACGTTTATGATCATCTGT
TACAGCAGCCTCAGGAAACTAATACAGGTGGGTTCATAGAAAGTTTTCTGGCCCCAAGCTTCCCAAAATT
ATTTAGAACTCCAGCTAAGACTCAACTGGTGTACTTTCACTCTTTGACGTACATCTCCCCATGACTTTCT
CAAGAGGTGTTCCTAATGGTGGTATTGGGACTGCTCTTCTATTACCCTTTATGACCTATACACGGTTTGG
GTCTAACTTTGGTCTTACTCAAAAGGTAATTAGATCCTGATAAAAGGCCTCTCAGAAGATCCATTTATTC
ATCCATTTATTTATTCAACCAGTATTTATTGATCACCTACTGGCCATGTTTTAAGAACTGGAGATAGAGC
AGTGAACAAGATAAAGTCCGAATTCTCAAGGAGTTTTTATCTAGTGGGGAGACAGAAAATAAATGAATGA
CTAAACTCAAGTTCCTGTAGTGATAAGTTCTGTAGAGAAAAATAAAGCAGGGTAAATTGTAGGTATGAGA
CAGTGCTTGGGGGTGGCTATTTTTGAGTGATTAGTTAGAGAAGGCCTTTTTGAGATGATGACACTAGAGT
AGAAATCAAAATGAAGTGAATGAGTAACCTATGGGAAGATCTGGGTAACCTACAGCATTTCTGGCAAAAG
AAAAGGCAAGTATAAAGGACCTGAGATGGAATTGAGCTTGGCTTGTCTGAGAAGGAACGGGAAGGTCAAT
GTTAGTAAGGAGTTAGGGAAGATGAGAGGAGTTAGGGCCAAGATCACTCAGGCTTTGTTGATCATTGCAA
GGAGTTGGGATTCTATTCCAAAAATGATGAGAGGGTGGAGAACACTGGGAGGTTTTGAGAAAGGGAGTTG
TTTCCTCCTCTCTCTTATTCAGAATACTTTTTTCATTCATTCATCAAATATGTATTTATTCTCCATGCAG
TGGTAGGCACTGTTCTAGGTTATGCCTATTGTACCAGTATTCAAACTGCTCTAGCTAAGACACCATTTTG
TGGTCAGCATTCCAGTGGCGTATGAGAACAGAGGGAGCTGTGTTGGGATGAACTCTAGAGTGTGCAGTCC
TCACCTCCAGAGACCCTTTCAGCCGTGATTACACAGCTACCCAGTTCTCACAAGGAACTTATTCAAAATC
CCCTAGAACCATTAGACAAGCAGGGCATTAGTATCAGCAAAGCACCAAATTCCTCTTCACATATCCCCTC
CCATATCTCAATGAGCACAGAGAACCTAAATAATTTAGCTGCTACAAACAACCCTCGGTTACAAAAGTTC
CCCAATTTAGATGTGCAAACTTATCTGGGTTTTGGAGCCTTCCTTGGACTTACCCTTTTGTAGGGGTGCC
CAATATGCCTTTGTTATCCTGATTTCTTCTAACGAGGAAGAGGGCCTGGTACCCCTATTAGTGTTCATGA
AGACCCTGAGCAAGGAAGATGATGCAGACATTAATGTTCATGTTAAAAGTCAAGGTGGTGTTTTTATGAC
ATTAACTGTATTTGGCTGAAAGACCCGGAAATTTCCCAATTCTTCCTCTCCAGCTTCCTTAAAGAGCTAC
TCACACAAGGAGCAATATTTCAATGGATGTTATAGCTTGAATGTTTGTGCCCTGTGAAATTCTTATGTTG
AAATCCTAACCCCCAAGGTGATGGTATTAGCAGGAGAAAATTGTGAAGTAATTAGGTCATAAGAATAGAG
CCTTTATGAGTCAGATTAGTACCTTTATAAAAAAGACCCCAGAGAGCCTCAGGCTGTCATTCTGCCATAT
GAAAATACAAGAAGGAGGCATCCGCAAACCAGAAGAGGGCCTTCGCCAGAACCCAACACTACCACCCTGA
TCTTAGACTTCTACCTTCCAGAACTGTGAAAAGTAAGTGTCTGTTGTTTATAAGTCACCCATTCTGGTAC
TTTGTTACAGCAATTTAAACAGACTAAAATAATGGGAATAAAAATAATACCCTGGGGCAGTGCCAAGCTA
GGTCGAAGCAAAAGTGGCCTGGTCTTAAGGCCTAAGTGGGGTTCCCTGCTTATTCCTATGCCTGAATCCA
GATCAAGGCTCTTTCCACCTCCTAGCCAACTCCAGAGTTCATGGAAGCAGTGATCAGCACAGTCAGGCGT
GGTATTCAAAAGTGATCAGAGGCACACAGGACCCCGTGCATGAGTGCGAGAGCTTGGCTCGCAGAACCTA
CCACACGCAAGATGAAAGTTGTCCTTTTTCCCTTAACAACAGCTATCATCACAAAAATATATAAATTTAT
ATAACTGCCTGCCCCCAAGTGTTAGAGTAGGTACTTAGGCAGACATGAGCAGGACAGGAGAGGGGCCCCC
CAACCAGGAATATCAGGTGACCATCAGGTGATGATCAGGCAGTTGTTAAACAGTCTCTCTAAGCCGGGGG
CCATGGCTCACGCCTGTAATTCCAGCACTTCGGGAGGCTGAGATAGGTGGATCACTTGAGGTCGGGAGTT
TGAGACTAGTCTGGCCAGCATGGTGAAACCCTGTCTCTACTAAAAATACAAAAATTAGCCGGGCGTGATG
GCAGGTGCCTGTAATCCCAGCTACTGGGGAAGCTGAGGCAGGAGAATTGCTTGAACCCAGGAGGCAGAGG
TTGCAGTGAGCCAAGATCATGCCATTGCACTCCAGCCTGGGCAACAGGGCTAGACTCTGTCTCAAAAACA
AACAAACAAAAACAAAAAAACAGTCTCTCTAGAATAATAATTGTTTGCAGCCAGCATCAGGGAAAGTCAG
TCTCCTAATAGATAGAAAACACACCTGAAGCTGGTGGTTAGCAGACTCCTGACAAACTCTCAGGAGCTGG
GCAAGCAGGCTTGAGCATGCATACCAAGAGGCAAAATGGCGGACTTCAACGGGTATGTGACCTTCCTCTA
GGAAGACTTGTCTGGCAAGGGAAAAATGTCTCCAATGAGCATGTACACAACTTCAGTAAACACAGTGTGT
GTGCAGCCCATCCCAAGGGCTGGCAGGCCACTGCACATGCAGACAGCCCACCCCAAGGGAAGAATCAGGG
GAGAAGAGACGCAAGACTCCAGAAGCCTGCCAACAAATAAGCCCCAAGTAATAGGTTAAACTGGGCACTT
GGATCTCTCAAGTTGCCCACTTGGCCCTCCTCCAAGTGTACTTTATTTCCTTTCGTTCCTGATCTAAAAC
TTCTTAATAAACTCTCTGTAAGGAATATGGCTGTGCTTTGGTCAAGGATAGGCCAAGGTAAACATCCAGA
GTGACTCAGCGAGTTTAGAGCGCAGGCGTATAACTCACTTTTTATCATAGCCATGTAGACATAACATAGA
GAAGCTTACCATAGCCATAACATAGGGAAGGTTCATCCCTTGGCTCTAAGCCACTATTGTCCGTAAATGG
TATAATTGCCCTGCTGACGCTGTACAGGTGCATTGGCAGCCAGAGAAAGAGAGAGAGAGAGAGCCAAAGC
TGTCCATCTTTGCAGATGGACTGAGGGGAGCCAGGACACAGCTCGGCTTGCTTGTACCCAGAGAGAGAAA
GAGTTAAGCTGCTGACCCTGAGGGCAAGGGAGAGCCGGACGCACAGTTGTGTGTGGAAGCTGCCGAACTA
AGCAGCCAGGACAAGGCGGACAGTCTGAGAGAACTACTGTAAGTAAGCTGCTAATGAGAGCTGTTGCTGA
ATAAAATCACCTTTCACCTGCCTACGGCCCCCTGAGTGTTCTTTCAGCTATCTGCTCATCCACCCCCTCC
CCTCAGACCTCAGTATGGGCTGGAACCTGGCCCTGGGCGTGACACTCTCTCTCTTACTCTAAAACTTGCC
TCGGTCTCTCACTCTGCCTTATGCCCCTCACACAAATTCTTTCCACTGAGGAGGCAAGAATTAAGTTTCT
ACGACCCATATGGATTCACCACTGCTAACGCAAGCATTTAATGAAAGCATAGCTTCAGTTTTATGTCGAG
CTAAATTAATTGACTCAAATATCTTCTATTTGCCTAACCTCCATCTTGCCCTTTCATTTAAAGTCATTAA
TTTTAAGTACTCAGTTTATGAAACCATTCTTATTTCTATAATTAAGAAATCAAAATGTTATACACAGGAA
TAACTGATTTTTAATACTTCCAGGATCTTTGAATTTTATATACCAAACTTGCTAAATCCATGAAAATCAA
TGTCTCAGTTTCCTAGACCAAAGAATTTTTTGATCAACGTCTTAATGACCATGACTGAGCCTCATCTATT
TTAGAACCTTTAAACTCTTTTACTATCCAAAAAATAAGCTGAGCAGAAAAGGATGCTTTAATTTGAAAGT
GTAAAATGCCTCTAGGTGAGCTTCTGTGAATTTTCATTATTATGATAGGTTTAGCCTCACATTATATGAT
ACAATGAATCAATACATTTAATTTGTCTTCTTTTGGAGACTTTGGAGGCATCAAATCAAGGCTTTGACTG
GTCTTAATGGACAATACCCATACAATCTATCTGGCCCATTAAGTTTAGTCCTGTAAATATTTACTAAGGG
CCTTCTCTGCACAAGACCAAATAGCTATTAACCAAAGGTTAAAAGAATCTGAGACAGTTCAAGAACTGTT
CTGCTTTGCTTTCTATGCGGTTTTGTGAACTCTTGCTTTGTTATAAAACAAATTCACTTTCAAGTCTTTT
GACCAAATTGGATGTAGCCTGGGAAACATTTTCAAAACCTGCAATTCTACCTCACGTCTAGCTCCCCAGA
ACAGTGTTAGTGGCCTGAGAAACAGAAGGACTAGCTAGTGGGAAGGCCCCAGAGAGAAAAACTGAAACAA
ACCTGGCCACAAAAACAGAAGAGCTGAACAGCAGCATTGCCTCCGGGAGTAACTGACTTATATCTCATTT
TCTTTAACACTGAGAAGAGAATACAAATGGCGGGATTAGGTGAAGAGAAATGCTGTCAAAATCAACAACT
AGCAGCTGCTCTGGAAGAAAACCAGAAGACGTGTGTGACCCAAATATTCATTTCCCAACTCAAAAATATT
TCCTATAAGCAAATCACACACGAGGTGTTATTCCCAGAGGAGTGTGGGGACTTTCTCTGATTTAGGACTC
AGAACTGATACACAAATGCCAGTACAAACTACACAGTAACTATATACATATCAGAAATATAACCCACTTA
GAAAAACACCCAGGACTTACACAGATTTTTGAGACTTCTGTACTTAATAACTAGCTATACAATTATTTTC
TTTTACAAAAGAAAAGAATGTGTTGCTTACCAAGACAACCTGCTTGTCTGTTCCATTTGGCAGTCTG
Protein Sequence
>gi|41350337|ref|NP_003254.2| toll-like receptor 1 precursor [Homo sapiens]
MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSK
LRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQ
LKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSV
KTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISN
VKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPF
LHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFS
SLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPE
SYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSLCSYLDLPWYLRMVCQWTQTRRRARNIPLEE
LQRNLQFHAFISYSGHDSFWVKNELLPNLEKEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPN
FVQSEWCHYELYFAHHNLFHEGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWA
NLRAAINIKLTEQAKK
Molecule Role Vaximmutor
Related Vaccines(s) Bacille Calmette-Guérin (BCG)
References