VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

human IFNG

Gene Name human IFNG
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 3458
NCBI Protein GI 56786138
Genbank Accession AC007458
Protein Accession NP_000610
Taxonomy ID 9606
Chromosome No 12
Gene Starting Position 68548549
Gene Ending Position 68553520
Gene Strand (Orientation) -
Protein Name interferon, gamma
Protein pI 10.01
Protein Weight 18454.87
Protein Length 166
Protein Note Also known as IFG; IFI
DNA Sequence
>gi|224589803:68548549-68553520 Homo sapiens chromosome 12, GRCh37.p5 Primary Assembly
AGTTGTGAACTTACACTTTATTCATATATATTAGATATTGATAATTTTAACAAATGAGTTACTTTCCATT
TGGGTACAGTCACAGTTGTCAACAATATTTGGAAGCACCAGGCATGAAATCTCCTGAGATGCTATGTTTT
CATCAGGGTCACCTGACACATTCAAGTTCTGTCTGACATGCCATTAAAGCACTGGCTCAGATTGCAGGCA
TATTTTCAAACCGGCAGTAACTGGATAGTATCACTTCACTTATAAGTGTTCATTGTATCATCAAGTGAAA
TAAACACACAACCCATGGGATCTTGCTTAGGTTGGCTGCCTAGTTGGCCCCTGAGATAAAGCCTTGTAAT
CACATAGCCTTGCCTAATTAGTCAGAAAACAAAGGATTAAGTGAGACAGTCACAGGATATAGGAATTATA
AATAATACATATATTAATAGATATTCATTTTCATTACACAAAAGTTGCTATTATAAATACTTATTTGATT
GATGAGTCTAAAAATATATTCCCCATATAAATAATGTTAAATATTAATAAATAGATTTAGATTTAAAATT
CAAATATTGCAGGCAGGACAACCATTACTGGGATGCTCTTCGACCTCGAAACAGCATCTGACTCCTTTTT
CGCTTCCCTGTTTTAGCTGCTGGCGACAGTTCAGCCATCACTTGGATGAGTTCATGTATTGCTTTGCGTT
GGACATTCAAGTCAGTTACCTATCGGGAAAGAAAAGAGCAAAATTAATTTCAGGCATATAAGCCATCAGG
ATATTCTGCTAATGTCATGATGGTCAGTGAAAATAAAAGTATTCCTTTAAAAAATGGACCGTATTACCTT
AATATACAATATTTACTTCTTCAGCAGTTGAAGCTAAAAATTACAATTACATTTCTAGTTGTGCTATAAT
GTGGTGGAGTCCATCACATATCTTTAAATCTACTTCTATAGAATTCTTGAAATTATATAGTGAAAAGACT
CCTGGTTGTGGAGTCAGCATAAAAAGGTGGGTTTGAATCTCATGCATGCAATAATTCTGACCTTGAGCCA
GCTACTTAACCTCTCTGAACTTCTATTTTCTCATCTAAAGGAGGATGAGACTGTTTCTATGACCTCTCTA
TCATCAATCTACCAATTATATCACTTTATACTTCAGTCTTTCCTGTATGCATCAAATGAGTAACTATAGG
TCAATGATTCTCACTGTTGTGCATAGCAGATTAATCCGGAAACCTGTCAAAGACCTCAGAGATCCAGGTG
CATGAAGTGGAAGGACTGTGCCCTGTGCATTCACTAAGCTCCCCAGGTGATTCTGACATCCACCTAAGTT
TGAGAACCACTGATCTAGGTTAGGTACCCTAGAAAACACCAAATCCAAAACGAGTGAAAACTGTAATTTT
TAATTTCTCCCAGATTAGGTCAGTCTCTCAATTTCCATAATAGATTTTAAAATAAACACCCCCAATCATA
TTTATATATGGCTTACTGATATATAAAGTTTAAAATTAAGAATTGCAACAACTTTTCCAGTACCCTGCCT
TCTAGGCAAGCAAATTGAACTACTTGCATCTCCTCACTCTAACCAATAGGGCCATTTAGATGATGCTTCA
TAAAATGTGGACCATTTACCTTCCTCTTGGCTCTGCCATTACATTTTTTCTAATCTTGGGAACACTATGG
CTACTCACCACATTTCTGAGGATGGCTGGGGGATTACAGCTAAAGACTAATTGTCAAAGGGCATAACATG
CATAAAATAGCTTAGCAACTGAGCCAAAGAGAATAATAATTAATAGAGCTCACTCAAGATTGCCCATCAA
GAAACAGGAGGTTTGTAGCTTCCAGAAGGAAGAAACCACAGATTTTTTTTCATTTTTTTAAGGCCCAGTT
CCTGCAGAGTAGAAAAAATTTTCGACAAGCTGTGTGTTTGCAAGTGACAGATTTTACTTTCCAATGTTCA
AATCATCACCAAGAAACTAAGAGACTTATCCAGGACTGAACAGTAAGCCAGGGGCACCACTGGATTAGAA
ACAAGTGCTGAGTGTCTAGTTTATAACCAAAGGAGACCTGTTGCCATGTCTCTCCTTTCTGTTTCTGGGG
GCTTACATGAGAGGAGTGAGAGGCAGGCCCAGCAATAGTGAAAGCTGAGCACATATCCTAAGAACACAAA
TGCTAGCTTGAAGACCCTGGTCCCTCTCATTTGAGCCCATTTATATCAAAGTCAACCCCAAAGGAATCTA
GAGGCCTTTGTCTTCTAGAAAACATTTTGAAAAACATGATTTGTCTTTATGCCTCAACGTTATCTTTCTG
TTTATAGAAGCCATAACTTAAAGATACAAGTTCATGAGGTAAGACTTAGGAGTCTAAGGAGTTCTCCAGC
TGAGATATTCTGAAAGTTGATAGAGAGTTGATAGAACAATCTTTTCATAAGGTATAAATTCTATCTATTT
TTCCCTAAAAACAAACAAACAGCAACCATTCTTGCTTCTAATTGGGCAGTACAATCTGATAGGTTGGCTA
GAGACTTGCAGTGGGGTGTCCCTGGTACCTATTCAAAGACTGTAGCTTTCTTCTATCTCATTCTCATTTT
CTATTCTTTGCATTGTAGAGTTTTGGAGCAAAGAAGGTCATCAAACTTATACAGTGAGCCTAACAGTTTC
CTTTTAAGATGAGGAAACTGAGCCCCAGCCAGCCATGTGATTCATCACAGTTCCTTGGTGGCTGAGTTGG
GAGGAGAACACACATCTTCTCAGCTCCTCCCACTGCTCTTTCCATTAAGACAGACAGCCTCTCATTCAAA
GTAAGAGAATTTCCATCATATGAGCAAGGGACAATGAGAGAACTGCTTCTCAGTACTCCCCGCTTCTTCC
TCACCTACTTCCTCTTCACTGGATTTGTCAACTCACCTGTCTTTACGCAATAGTTACAATGCCAGCATTT
CTCTACATTACATACTTCAGCGATTCTCTTACTGGCTTTGCAAAGTCACCCAAACACGAATGGAAATAGT
AAGGTAGAGTTTCAGCCATGAGTTGAGTTCATAGCTTTAGCAACTGTTAAATAGCTAATGTCTACTTTCT
GGAGAATAAATGCTTTGCAAGACCCTCGGCAATGAAACCAAAGAAAGAATTTAAATAGCCTCACCGAATA
ATTAGTCAGCTTTTCGAAGTCATCTCGTTTCTTTTTGTTGCTATTGAAAAACTTGACATTCATGTCTTCC
TTGATGGTCTCCACACTCTTTTGGATGCTCTGGTCATCTTTAAAGTTTTTAAAAAGTTTGAAGTAAAAGG
AGACAATTTGGCTCTGCATTATTTTTCTGTCACTCTCCTTGGAAGGAAAGAGCACAAACAGAGGATGATG
TGAATTTATCCATCAGAAAGCAAGCAACAGGAAAATTAGCCAAATGGGAATATTCAGCTTACCTCTTTCC
AATTCTTCAAAATGCCTAAGAAAAGAGTTCCATTATCCGCTACATCTGAATGACCTGCATTCTAAAAAAA
AAAAAAGAAAAAATTGGTTTACAATTAGCCCATAAATTGCCTTAAAAATATATTTCAAGTTTCATTGAAC
TCAGATGTGACAATATTCACTGATTTCCTTTTCAACTCTTCTGCTTAGTTCTAACAATAAGTATTCCCAA
AAGGCTTATGTGAGATATAGACAAAGACTATTATGTTCTTTTAGCTTTTTTATTTCCCAATATAACCATT
AAATTGCAATGTCACAAATGAGCTCAACAAAGCTGATACTCCAAAGGTCCCAAAAACTATAGTAAGCTAA
AGAAAGTATTTTCAAGCTAGGCTAAAAAATACAAAAACAAAAAACAGCAAAGCCACCCCACTATAAAATA
CTGCCCCCCAATGGTACAGGTTTCTATTACATCTACTGTGCCTTCCTGTAGGGTATTATTATACGAGCTT
TAAAAGATAGTTCCAAACATGTGCGAGTGTGTGTGTGTGTGTGTGTGTGTGTGTGATTTGATTTTGTGTT
GTAAGAATAAAATCAATTGTGAATGTCTGAATATTATTATGACAGCTATAATTATAACAGCTAAGTTTTA
AACAAATAATGAAATATTTAAAATGTAAAAACTTTTCATTAACCATCAATAAAATTTTAAAAGAAACTCA
AAAAATTCACTTAAAATTTTTAAACATTCCTTAGCCAGAATCATAATTCTTCCAAAATCCCAGTGAGCAA
CGAAGTTCCGGAATACTTCACAAGTAATATAGATAGAGAAGCAGAATGTTGAAATCACTTTTTGGAGAAA
ATCACCTATCAGTTATTTTTTTAAGCCAAAGCTTTAAGGACCTTTTTGACTTTAATTTGTAAACATTTCC
TATTACCTTTTTAATGCTAATCTTGACCTTAGAGTCTGAGAAGTCAAAAACTAATAACCAATCATTTTTT
TCAATCTGCATACTCCTTGACTATCACAACTGAATGAGTTCCCACCACAAAATTATTAACATCATTATGC
TTCATACCCATATTATGCCCATCTTTTGGAAAATTCATAAATCCCTTTTAAGTCTCTATACAAACTGAGC
AGAAGGTTAAAACAATATCTAGATTATTTAGTCAAGGAACTCATCTAGTCAATAATTAACAAAATAACAC
CAAATCTCAAAATGACTGCCTACAAGAGATGACAGCCTATCAGAGATGCTACAGCAAGTCGATATTCAGT
CATTTTCAACCACAAACAAGTACTATTAAAAAGTCATACTTACAAAATATTTCTTAAGGTTTTCTGCTTC
TTTTACATATGGGTCCTGGCAGTAACAGCCAAGAGAACCCAAAACGATGCAGAGCTGAAAAGCCAAGATA
TAACTTGTATATTTCATCGTTTCCGAGAGAATTAAGCCAAAGAAGTTGAAATCAGTAGTTCTTGTATCAA
GCTGATCAGGTCCAAAGGACTTAACTGATCTTTCTCTTCTAATAGCTGATCTTCAGATGATCAGAACAAT
GT
Protein Sequence
>gi|56786138|ref|NP_000610.2| interferon gamma precursor [Homo sapiens]
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS
QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM
AELSPAAKTGKRKRSQMLFRGRRASQ
Molecule Role Vaximmutor
Related Vaccines(s) Bacille Calmette-Guérin (BCG)
References