VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IL2

Gene Name IL2
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 3558
NCBI Protein GI 28178861
Genbank Accession AC022489
Protein Accession NP_000577
Taxonomy ID 9606
Gene Starting Position 123372624
Gene Ending Position 123377649
Gene Strand (Orientation) -
Protein Name interleukin 2
Protein pI 7.95
Protein Weight 17130.78
Protein Length 153
Protein Note Also known as IL-2; TCGF; lymphokine
DNA Sequence
>gi|224589816:123372624-123377649 Homo sapiens chromosome 4, GRCh37.p5 Primary Assembly
GTTTATATTTATCAAATTTATTAAATAGTTTTACTAACCAATCTACATAGATACTATATTTAACATTCAA
CATAATAATAAATATTTTGGGATAAATAAGTGAAACCATTTTAGAGCCCCTAGGGCTTACAAAAAGAATC
ATAAAAGATCCATATTTATAGTTTTAAGATTAAGAATAATAGTTACAATAGGTAGCAAACCATACATTCA
ACAATAAATATAAAATTTAAATATTTAAATAAATAGAAGGCCTGATATGTTTTAAGTGGGAAGCACTTAA
TTATCAAGTCAGTGTTGAGATGATGCTTTGACAAAAGGTAATCCATCTGTTCAGAAATTCTACAATGGTT
GCTGTCTCATCAGCATATTCACACATGAATGTTGTTTCAGATCCCTATAAAAGAAAAATGTTAATTTTTT
AAAGTACAGAGTAGTTTACCTTATATACAGTTATTCCCAATTGAAGTCTTATAGGCCTGTTGCCTTTATT
TTCAAGCTTACCAAACATATTAATTATTCACATTTTCTTGAAATGATCAAAATGAATGCCAAAATTACAT
ATTTTGTTATGATACCAAATGATAGTAACACAGAAGCTGAGATTTTCCTCATTTGTTAATTCAGTCAATG
AACACAAAAATTTTTTCCCTAAATTGGGTGCAAATAAAGATTTAAATAAAAATAGATCTAGACAAATATT
AAATGCTGGATGTGAAATAAACTTGATCGCTTTTCCTCTGAATGTACACCTATATTTGTGTAAGTTAAAT
GTATGAATTGATATGCACATTATACTTTCTTCTTTTCTAAATCTTGATTAGAGTCTCCTATTTTTCTACT
TAAGTGAATCTCCTTATATTTTCCCCAAAGCAGAACAGAACTACACTAGAGTAAGCTAGGACATGCTTCT
GTTTGGGATAAATTTGTGTGAAGAACATCTTCATAAATACTTACACCTATCCCTACCCCATCATAGTATC
AATGCAGGTGAATTTGCCAACTTTTAAAAGTTTAAACATTAGAAATTTTGTTCTGTGGACTGGCTTTTTA
GAAATTAGGCTTCTCTGCTGAAAGGAGCTATTTAAACGCTTCCTCTAGTTGATAAGCTAAGGAGGAAATA
TTTTGATATATAGTGAGATTTAAAAGAGAGCTTTTCAAATTTGAAGTGATTCCTACCCTGGGAACAAAAG
CAGGTGAGATAGAGTGTTCCCTTTAAATAAGTATTCTCTTTTAAAAAACTGTTGCAGTGTTCTGTATCCT
CTTAAGCATAATTGTTTAAATATTGTCATATCTTGGGATTTTTTTATTTTAAAAAGTGTTTGGCTTTTGA
AACACAGTTTTCAGATTTTTGCATGGTTTTGTCTTAAATTTGTATCAAGAGTTAAGAATGAGTTTTCTGA
TGTTAATTATTTTAGAGTAAAACTCTTGCCATAGATAAGGAACTGAATCTGTCAATGTCTAGATGACATT
GATCTCAATGTATTTTTTTAATTCAACTGAAACAGTCCACTAATAAGTGATTCATTTGGACACAACTGGA
GTTACTTTTAGGAATGTCTTTTACTACTATACTTATGCTGCTTATTTAGGATACCTATTAACTCATGAAT
TTTATACCTTAGGAGACGGGATATAAAAAGACAAAAGTGAATCTCTTTTACATCACCTGAGTCCCTTGCA
TATTTTATGCTTCCTGTGCATTTAAAAATACTTAAGATTCTGAAAGTGGGGATTGCCTCTAAAAAGATTG
TTGTTTGTTTAGTCCACTGGCCATTTTAATGGCTCCAGTTTTTTTTTTTAAGACAAATCTCTTATGGGTA
GTCCTTCCATCAAATGATAAGGAAACACCATTTGAAAAGCCTTTCAGGTAATCAGTATTGGCTATTCCAG
TAAATGATCTGAAGGAATTGAAAAATATATAGTAAAATCTGCCTGCTTTCTGTGAAACTCAACTCAGTAC
CTTCTCTCACTCCCAGTTTTGTGTTAATATGAAAGGTGATGGAGTTTGGGATGAGGCTTGTCCATTAGTA
GATGGTAGGTGCAAACTCAGTAGCTTATACTCCCCAGTTAATCATTTAACATTAGAAATGATTCATGTTC
ACAGTGTACTTAAAATGTAGGCTAATTACATGCATGGGTACTTTACAAATACCAAAAATGTTATGTCACT
TTAAAATGTGGTACTTTTCCCCCTACTTTTTTTTTTTTATTTCCAGGAGAGCAAATAAAGTAATGCCTTA
CCTTTAGTTCCAGAACTATTACGTTGATATTGCTGATTAAGTCCCTGGGTCTTAAGTGAAAGTTTTTGCT
TTGAGCTAAATTTAGCACTTCCTCCAGAGGTTTGAGTTCTTCTTCTAGACACTGAAGATGTTTCAGTTCT
GTGGCCTAGAATAATAATTATCATCAGCTCAGTTTACATAGAGGTCAGAATCAGAAATTAATTTCCAATT
TATTTTATTTGGAGTAGCAGTATGTAGTTTTTACCATTCTCTCTGTTCTCAATGTCACTGTAAAGATGGA
CCAGTAGAGTTTACATTATAAAACTGGAAAAACTAGGGCTCAAGTACCTATGACTAGCGTTAAGTGATAG
TTGACTCACTGGTTTTAGCTTAATTTGGCTTTGCAAAATGTTAGACTTTCTGCATCTAAATGCCTATTAC
AGATGTAGGCTGATTACTTTTCCAATCTGCATAGAAAATCATTAGAACCAGATGAGTTAGAATGTGGAAG
CATAAAAATCACATTCTATGATTATAATATTTGATAGTCTAAGAGTTAAGAATCACAGAATGTTGAGAGA
GAAGGAACTCTTGGATGCCATCTATCACAATCCCAACATTTTACACTAGGTAACAATAATCATGTAGTAG
TGGCTCTCAATATAGCCTTGAGCAAGACACATTTTTAAATATGTCTTAAATTTTTACTTTTCTACAATCA
CTACATTAAGATGCATTTTAAAAATGTTTGTCCCAGTGAAATAAAAAATTATAATACTTTGGGAGGACTT
TTGGACAGGCCTCTTGATTCTATATTATATATAATATTTCATATTTCTATGGTATATTACAATTTAAAAG
AATTTTCTCCAAAATAGGCCCATTTACTTCTCACAGTCATCTTTTGAAGTAGGCAGTGAAGTATCATCTC
CACTTTATAAATAAGCACACTAAATCTCAGAATTTGACCACATAAGTAGGTAGAGCCAGAATTAGATTTC
ATTTCTTTCTCATTATAGCATTAACATAGCATCCTTGGAATCAAATATTTTTATTAGTTTCTAAAATCTT
TTGTAAATGTGCAATGAGGGTTAAATGAACAAATGAATAGAGTTTATCATTACTTTTGGTTTCAAACTTA
GATTTCCATGAATTCTACCACCCCCTAAATTATGCACATAATCTCATCTTTCTAACACTCTTTAGTGGGA
AAGGTAGGTCAAGACAATACCAATCCCCTGATATGTCCATCTATTGCGCTTTCAATTCACCACTACAAAT
TCTACAAATTCGGGTTTAAGTTTTTGGCATGAACAATGTGGAGAAATTTTCTTCAGAAAACAGCATCTAG
TATCTTTATGTTGCTGGAGTTGCATTATGTGGCTCTGATTAAACTAGAGTAACATCTGTAAGCTGTCTCC
TTTACATCTTTCAGAAGGGTAGTTAGAAGCAGATTTCTCTTGAATTAATAGAATTTGAGTCAATGGGATT
GCATCTGTGTCCCCTTAAATCCTATTATTTTCTGGGCTTGGATTCACCCTGGCACAAGCTCTTTCTGGCA
CCAGATTTTGTTCATTCTCTCTTAACTGGCACAGCTACTAGGTAGCTTTACACACCTAATGTAGCCTAGG
AGCTTGGATGATTATGCTTATGCTCTATCTGAATCCAAAAACAACCTAATGAAGCTTTTAATCTTGGAAA
ATAAGTCATATAGCATTATAAATCTCAAGTTCTATTGGTAAAAAGATAAAGTCCAAAATTTTACTTTGTA
TTTCTCAGTGAAAATTTTATCTTTAATACTACTAATAATAGCTAATGCTTGTATGGTATTTACCTTATGC
CAGACACGGTTCTGAGTGCTTTACATTTACTTACTAATTCTCACAAAGCCATATTAAGTATATACAGTTA
TTCATTTAAGTAGACATGAAACTGAATCACAAACAGAGTAGGTAATTTGCCAAAGATCATGAAAGCTAGG
ACATGGCAGAGCTGAGATTTCACTTCAGATATCTGGCCCCAGACTCTGTGCTATTAGTGTTATGCTGCCT
CTCACTTAGAAACCTTTCCTAAAACAAGAAAAGATTTTTAAAAGTGGGCTCCTTGGAAATAGATTTTGGT
ATTTTACATACTAAAATGACATAATCAAATATTTTAGAGTTTTACATTTTTAAATGAAACCATAAATGAA
CATTTTTGTTTAGAATTGTCTTATCGATAAAGTGAGAATATTATTTTTATGTTTTCTTCCCACCCCCACC
AACACACAAATATATATTAAAAATATAGGTAAAACTGTTTTAATAGAGGCTTCATTATCAAACTTGGGTT
TTCAAAAAAACAAATTAAAGTTACTCTTTACCTCAGATGAGCTGCTATTAGTCCCATCTGTGCAAATTTT
CATATTACTTTGAATTTTATTAAAACAGAAATTGAACATAAAATATTGTACTTACCTTCTTGGGCATGTA
AAACTTAAATGTGAGCATCCTGGTGAGTTTGGGATTCTTGTAATTCTAAGAAAGTATAATGCATTGTTAT
TAAGAAATGATCTCCAGCTAGATTACTAAATGTAATAATTTTAGTAAGAAAGGAAATATACTTACATTAA
TTCCATTCAAAATCATCTGTAAATCCAGCAGTAAATGCTCCAGTTGTAGCTGTGTTTTCTTTGTAGAACT
TGAAGTAGGTGCACTGTTTGTGACAAGTGCAAGACTTAGTGCAATGCAAGACAGGAGTTGCATCCTGTAC
ATTGTGGCAGGAGTTGAGGTTACTGTGAGTAGTGATTAAAGAGAGTGATAGGGAAC
Protein Sequence
>gi|28178861|ref|NP_000577.2| interleukin-2 precursor [Homo sapiens]
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKA
TELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNR
WITFCQSIISTLT
Molecule Role Vaximmutor
Related Vaccines(s) 2008–2009 trivalent influenza vaccine , Bacille Calmette-Guérin (BCG)
References