VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Cxcl10

Gene Name Cxcl10
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 15945
NCBI Protein GI 10946576
Genbank Accession AC109603
Protein Accession NP_067249
Taxonomy ID 10090
Chromosome No 5
Gene Starting Position 92346637
Gene Ending Position 92348888
Gene Strand (Orientation) -
Protein Name chemokine (C-X-C motif) ligand 10
Protein pI 10.57
Protein Weight 10391.5
Protein Length 98
Protein Note Also known as C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
DNA Sequence
>gi|372099105:92346637-92348888 Mus musculus strain C57BL/6J chromosome 5, GRCm38 C57BL/6J
ATTTCATGTCAGTTATTATTACTTTATTACATTTTGGGTCTCTTACTACTTTCAATACAGTACATTGTCT
TTTGAATGTTACATAATACAAAAGGTATTGGACGGTTTTAAAAATAAACTTTAACTACCCATTGATACAT
ACTTGATGACACAAGTTCTTCCATATACAATGCAAAGCATACAAAAAATACATTAGGAATTCTACTTTGT
ACAGTCGTTCATTAAATAGTATTTACACATACATTTTCAGGTTCCTCTGAGTATCTTGATAACCCCTTGG
GAAGATGGTGGTTAAGTTCGTCCTTACAAACTTAAATTTGTAGTCTTACATCTGAAATAAAAGAGCTCAG
GTAAACTTAGAACTGACGAGCCTGAGCTAGGGAGGACAAGGAGGGTGTGGGGAGCAGCCTGGGCATGGCA
CATGGTGAAGGGCGTCGCACCTCCACATAGCTTACAGTACAGAGCTAGGACAGCCATCCCAGCCACTTGA
GCGAGGACTCAGACCAGCCCTTAAAGAATTCTTGCTTCGGCAGTTACTTTTGTCTCAGGACCATGGCTTG
ACCATCATCCTGCAGGAGGAGTAGCAGCTGATGTGACCACGGCTGGTCACCTTTCAGAAGACCAAGGGCA
ATTAGGACTAGCCATCCACTGGGTAAAGGGGAGTGATGGAGAGAGGCTCTCTGCTGTCCATCCATCGCAG
CACCGGGGTGTGTGCGTGGCTTCACTCCAGTTAAGGAGCCCTTTTAGACCTGTAGGAAGAGGAAACTGTA
TTGAGCGGAATAGACTCTGCTTTCACTTTGGGAACCCAAAGACCCTGGGGCAAAAGGCCTGGTGCATTTT
CCTCTGCTACACAATCTCCATGGGTCACGGGTGGGTGGGGGTTGAGGGGACAGAATGGGTTTGTGTGTTT
TTTGTTTTTTTTTTTTTTAAGTGAGGAAGTGGGGGGGGGGTGGGCATTTGGCAGCTTTACCCGTGACAGG
TATAATAACTGCTCCACTTCTAGACACTAGGAATGTATGACCTAAGAAGGCACCTCAGTGTCTGTGTAAA
TGGAGAGACAAAGGCACATGCCGGTGCCATGAGTTTAGGGCAGATGCCCCACAGCAAAGCCCAGGGCAGG
CGCTGCTCCCCAGACCACCATTTCCTGAAAAAGCAACATCAAACCTACCTTTTTTGGCTAAACGCTTTCA
TTAAATTCTTGATGGTCTTAGATTCCGGATTCAGACATCTCTGCTCATCATTCTTTTTCATCGTGGCACT
ATAGAAATAAGAGTGAGATACTCAGATTAACGTCAGGCCAACAGAGCTGATGGCCCTGCAGGTCCATGTC
AGAGTTCAGGCACTGTGCCTTAGTTAGAGTCACAGACCCGTCCCTATCTTTCCTGGTTTCCCTCACTTAT
TTACTGTGTGGTTACGGGAGGGACGTTTATCGGCAGGTGGGCTTGTACTCACATGATCTCAACACGTGGG
CAGGATAGGCTCGCAGGGATGATTTCAAGCTTCCCTATGGCCCTCATTCTCACTGGCCCGTCATCGATAT
GGATGCAGTTGCAGCGGACCGTCCTTGCGAGAGGGATCCCTGCAGGAAGAGAGGGGGAGAGCCAGGAAGG
TCAGCACACGGTTTCATTTTAGGCACTTAAAATGGATGAGGTAGTGTTTAGCAGACCCTGTCTGATCTGT
GGAGAGACGCATCCCATCGTATCATAGGGCTGAGTGTTTGAATATCTTGGTCATGGTAAAGAGAGATCTG
CAACTTGTCAGTTACGAAATCCTGCATTTATGCACTGCTCACAGTATTGGTTAGGCTCAGGCAAGGAGGC
ATCCGTGCCTTACCCCATCCCACTCTTTCGCCCTTTCTCCTGACTCTCTCTTCCCTCCTTCTTCCTCCTC
CCTCCTCCTTTTCTCCCTTTCTTCCCTTCTTCGTTCCTTTGCTTTTATTCTATTTTTCTCTGACTTCAAC
CAGCCTATGATAAACTCTGCAAGCTGAAGGGATTTCTTCCTGCTTCCCTCTTCTTTATAGGTACACACAT
TAAAGCTTAAATACATGCTGTGTTTAGAACTGAGCTTAATCGTCTGACTTCTGACTTCGTTAATTAAATG
GCCTTGGTGTCCCTTACCTTGAGTCCCACTCAGACCCAGCAGGATGAGGCAGAAAATGACGGCAGCACTT
GGGTTCATGGTGCTGATGGGGAGGCTTCCGGAAGGTTGGCTCGGGATGTCTCTCAGCGGTGGATGAAGCG
CTTCTCGAGTGC
Protein Sequence
>gi|10946576|ref|NP_067249.1| C-X-C motif chemokine 10 precursor [Mus musculus]
MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKND
EQRCLNPESKTIKNLMKAFSQKRSKRAP
Molecule Role Vaximmutor
Related Vaccines(s) B. melitensis WR201 (16MĪ”purEK) , MVA/IL-15/5Mtb vaccine
References