VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Fth1

Gene Name Fth1
Sequence Strain (Species/Organism) Cavia porcellus
NCBI Gene ID 100379547
NCBI Protein GI 290491181
Protein Accession NP_001166318
Taxonomy ID 10141
Chromosome No Un
Gene Starting Position 9448211
Gene Ending Position 9449938
Gene Strand (Orientation) +
Protein Name ferritin heavy chain 1
Protein pI 5.3
Protein Weight 20567.49
Protein Length 182
DNA Sequence
>gi|347623380:9448211-9449938 Cavia porcellus strain inbred line 2N unplaced genomic scaffold, Cavpor3.0 supercont2_65, whole genome shotgun sequence
CGCGGTCTCCTGCTTCAACAGTGCTTGGACGGAGCCCGGTGCTCGCCTGCCCTTACCGCCGCCCTCACCG
CCGCCGCAGTCTAACCTCGCCCGCCGCCACCACCACCACCGCACCGCCGCCGCCGCCATGACGACCGCCT
CGCCCTCGCAGGTGCGCCAGAACTACCACCAGGACGCCGAGGCCGCCATCAACCGCCAGATCAACCTGGA
GCTCTACGCCTCCTACGTCTACCTGTCCATGGTGAGCGCGTGGCGTGCAGCCCGCAGTGGGCGCTCGGGG
TTGCCTGGCGACAGCGCAAGCTCCCCAGGGACGGGAGTGCGCGCCTGGATGTAGGAGAGGCGGCGGCGCC
ACTGACCCCCCTCGGCTGTCTCCCGCCGGGGCGTGCACTTTGAGGGTGCAGCTGGAGAGCTCGCGAACCT
GTGTAGAAGATACCGTGCAGGGCGAACGCTCAACGCACTCCCTCTAGACAGGAGGATTTCCCTGTAAACA
CTGCTGGAGGTGATTTTCGGTGCTAGTTTGAAGCTTCTTGAAGCAGCTCTCAGCGACCAAGTCCCAGTTT
TTTGACACAAGATCTCACTGTGTAACCCAGGCTGCCCTTGAATGCACAGTTATCCTCTTGCCTCAGCCTC
CTCAGTGCTGGGATTACATGCGTGCTCTATCAGTTTTCTAGTTTAGAGTTAAGAGCCTAGTCCCTTTCAG
GAACACATCAGGCCCATTCAGCCCTGGCCCCTCTGGTTGTGTGGTGAGAAGGGCAAGCTGGACAGGCAGA
GGACACTCACCACCTCCCCTCGCGACAGCCATCTCCCTTCCCATGGGAACCTTCACTGGACGGTGATGTT
TATTTTCAGTCTTACTACTTTGACCGCGATGATGTGGCTTTGAAGAACTTCGCCAAATACTTCCTTCACC
AATCTCATGAGGAGAGGGAACATGCAGAGAAGCTGATGAAGCTGCAGAACCAGCGCGGTGGCCGGATCTT
TCTTCAGGATATCAAGGTGAGTGGGGAAGGTCTGGATGTGAGAGACTCTAGGGGTCCTTCCCTCCCCTCC
ATGTGCAGCTATGGCTGGGGCTCTCTGCCTCTGTGCGTGTCAGGGCCACTTTATGCTAATGTAGGCACTG
AATCTGCAAGGACAGTGAAGCAGCAGCTCTAGAGGGGAGATGTGGGCATTAGACCCCAGCACTCACAGAC
TGGGGCTGGCCCTGTTGGGGGGAGTCTGGGCACTGGTTGATCTGGTGCCTTTGCTCAGAAACCAGACCGT
GATGACTGGGAGAATGGGCTGAATGCCATGGAGTGCGCCCTTCACTTGGAGAAGAGTGTGAATCAGTCAC
TCCTGGAGCTGCACAAGCTGGCCACTGACAAGAATGACCCTCATGTGAGTACAGGGATTGGGCTGGCAGC
AGAGGGAGGTGGGGTTCACGAGGCACCGGGAGCCAACCATCTACCTCTTGTCTCCTAGCTGTGCGACTTC
ATCGAGACTCACTACCTGGATGAGCAGGTGAAGGCCATCAAAGAGCTGGGCGACCACGTGACCAACCTGC
GCAAGATGGGTGCCCCTGAGTCTGGCATGGCCGAGTATCTCTTTGACAAGCACACCCTGGGGGACAGTGA
CGAGAGCTAACGGTGCTTGGGCAGTGTGTGCATGCTGCGGCTACCTTTACCTTTTCTATAAATTGTACCA
GAACATCTAAAGTTCTTTAATTCCTTCAAATAAAGAGATTTGGTACCC
Protein Sequence
>gi|290491181|ref|NP_001166318.1| ferritin heavy chain [Cavia porcellus]
MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL
MKLQNQRGGRIFLQDIKKPDRDDWENGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETHYLD
EQVKAIKELGDHVTNLRKMGAPESGMAEYLFDKHTLGDSDES
Molecule Role Vaximmutor
Related Vaccines(s) Bacille Calmette-Guérin (BCG)
References