VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IL-1b

Gene Name IL-1b
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 16176
NCBI Protein GI 6680415
Locus Tag RP23-384K11.2
Genbank Accession AL808143
Protein Accession NP_032387
Taxonomy ID 10090
Chromosome No 2
Gene Starting Position 129364578
Gene Ending Position 129371119
Gene Strand (Orientation) -
Protein Name interleukin 1 beta
Protein pI 4.31
Protein Weight 29045.55
Protein Length 269
Protein Note Also known as Il-1b; IL-1beta
DNA Sequence
>gi|372099108:129364578-129371119 Mus musculus strain C57BL/6J chromosome 2, GRCm38 C57BL/6J
GTTTGTTTGTTTTAATGAAATTTATTTCATACTCATCAAAGCAATGTGCTGGTGCTTCATTCATAAAAAG
TCTCATCCATATTATAGGAACCTATTTATTCTCAGCTTCAATGAAAGACCTCAGTGCGGGCTATGACCAA
TTCATCCCCCACACGTTGACAGCTAGGTTCTGTTCTAGAGAGTGCTGCCTAATGTCCCCTTGAATCAACT
TAAATAGATCAACCAATCAATAAATACATAAATAAATAGGTAAGTGGTTGCCCATCAGAGGCAAGGAGGA
AAACACAGGCTCTCTTTGAACAGAATGTGCCATGGTTTCTTGTGACCCTGAGCGACCTGTCTTGGCCGAG
GACTAAGGAGTCCCCTGGAGATTGAGCTGTCTGCTCATTCACGAAAAGGGAGCTCCTTAACATGCCCTGG
GGAAGGCATTAGAAACAGTCCAGCCCATACTTTAGGAAGACACGGATTCCATGGTGAAGTCAATTATGTC
CTGACCACTGTTGTTTCCCAGGAAGACAGGCTTGTGCTCTGCTTGTGAGGTGCTGATGTACCAGTTGGGG
AACTCTGCAGACTCAAACTCCACTTTGCTCTTGACTTCTATCTTGTTGAAGACAAACCGTTTTTCCATCT
TCTTCTTTGGGTATTGCTTGGGATCCACACTCTGCAGAAAAGTAGAAAAAAGAATTGTGTTAACGTCTGT
GTCCGTGTGCATGTTGCATGTATGACAGAAAGGATAAAGCTACCACGGTAGACATATTCTCAGGGCTGCT
GGAGAAGAGAATGAAAAAGAGGTTGTGGAACTTGAGGCCACATTCTTTACTGCTGAACCCCATCTTTCTA
TAATCACTGAAGGAACCTTTGTTATATATATATTTTTTCTGAATCCTACCATATGGGTGAGAATTATATT
AAAGCTCCCAAGGGTACCCAGTTTCCAGGCATTTTTGTCACAGTTCCCCCTAAATCCCTGGATAGAGTGG
CATCAGCTTGGAAATGAAGCTTTTGTTAGGAATGTCACAAGTGCCAGTACAGGTCTGAGGATCGTTGGTT
GAACCCTTTCACTGCATTCTCCAAACTGTTCTCTGTCAAAGGAGGAAAAACTGTCACCATATACAACTCT
TTCATCCTTGATGCTACGACTTCTGTTGGGGGTGATAACGGTGGCCTGACATGACAACAGCATCAAAAAG
GATTGATTTCCCATGGTGGCAGTGAGGTTTATGTGCACTTAAAAGTTATGCTAATTTTATTCTATATTTA
TGTAAATCGTCAAGAAGACCTCTAATGTTTTCTGGCGGGTCAGGCAGGTGGATGTCTGGGAAGTAAGTAA
AGGCAGAGTCTTCGGTGAGCAGTGGGGGAGGCTTCTCTACTGATGGACTCACCTCCAGCTGCAGGGTGGG
TGTGCCGTCTTTCATTACACAGGACAGGTATAGATTCTTTCCTTTGAGGCCCAAGGCCACAGGTATTTTG
TCGTTGCTTGGTTCTCCTTGTACAAAGCTCATGGAGAATATCACTGGAGAAAGGAGAGGAGTCTGGGTCA
AGGGAACAGCAATGCAGGGTGGGCTCAAGCATTAGACGTGACAGGCAAAGCCTATGCAGTCCCCCGTGTG
AACCCAGAATGAGCCTCCTCAGACACAAGATATGGACTAGCAGGGCTATACAGTCATAGTCATAGACAGT
AGCAAGGTCAGTAGGCCGATCCAGGATTCCCTCAGGACCTCTTAGGAGCAGCAATGAAGAACGAAAGGTG
TCTAACTGTTAAGCTCTAAGGGCTAAAGCTGTTATGTGGCTGGCAGGCTGTGTGTCCGTCTACGTGAGAA
GTACAGTTTGGTCGCTATGAAAACAAAGCTGTGCTCCTAAAAGGACCTAGGGGCCAGCACGTTTTGAGGA
AAATAGAGCAGGAGGCAGGTAGAACTCTATTAGCTGGGGAGAGTGGCTCCAAAAAAGAGACCCCCCCCAC
TTTGATCTTAGCCACAGTACCTCAATTGGAGGCCCCTGGCTGCTTTTATGACTTTATCAAGAAATAAGAA
TTATTCTTTTTAAAAGGTATAAAGCAATAAGATTCTTTTCACCTGGACCAGAGTAGACAGCTCCCTCCAA
AGCTTCTAAGATCAGAAGCTAAAAGGAGACAGCACACACTGCTGCTGTTAGCTCTTGTCCCCTCAGCTGT
GGTGGTGTGGTGCCAGGTCCACACCATCATCTAAAGAGGCCCTGACCGCGCTTGGAATGCTTGTTATTAT
GGAAGAGAGATGTATGCTCCTGATAGTCAGCAAACCTCCCTTCAAGGAACTGTGTGTGTGGTATTGGTGG
GAAGGATATCAGCACGAGGGATAGGACTGGGAACAAAAATGGACATATCAATTCTCTACCATCTACATTT
CAGCCTCAAATGAGGGAAAAAGAACCCACAGGCAGTTATTGCATGTCCATCAAATGACTTCACACTAATG
TGTTATCCCTATATGACTGGGCTGGAAAAATGGTCCTTTTTCGTTCTGTCTCTGTCTCTGTCTCTGTCTC
TCTCTCCTTCCTTCCTTCTTTCCTTTCCCTTTCTTTTTCCTTTTCTTTTTTTGTATAATGACCATAGTGT
TCCATTTTAAAACACAGGGACCCAGTAGGCTGCCAGGAGGCCAGAAAGGGAAACCAAGATGCTCCTACTT
ACCTTGTTGGTTGATATTCTGTCCATTGAGGTGGAGAGCTTTCAGCTCATATGGGTCCGACAGCACGAGG
CTTTTTTGTTGTTCATCTCGGAGCCTGTAGTGCAGTTGTCTAATGGGAACGTCACACACCAGCAGGTTAT
CATCATCATCCCATGAGTCACAGAGGATGGGCTCTGAAAGTTCAAGAGCAGATGTTGTTTAGGCAGATAA
TTAGAAATGCAAGCACTGTGAAGTGAAGCAGCAGAATTTGGCTTATTGAGCAACACCTAAGCATGTGCAG
TCAAGATTCTATTCTAATTTTAGTGGGGGTATAAAAACACTGGGAGTGGGCTGGGCAAGAACATTGGATT
TGGCATCGTGAGATAAGCTGCAGTGTTATAACCATTCACTAGGGACTAGCAGTAGTGGTCCTTGCATGAA
ACGATGCCAGTAATAAGACCAGCTTAACTGGGAAATTGTGAGATTCACAACCTCTAGTATAAGCCAAAGT
ACTTGGCAAGTCAATGGTTGAGTTGCAAGTGTAAGCATCATTAAAGCCTTTTTATAAGTTAATCAGCTCA
AGATAGAACTGATTTGTTTGGAGGTTTCCTCATTTTCTTCTAATGGTTGGAATGTCTAGCACTAAGGGTC
TTGCACTTGAGGGGCGTTGAGTTCTAAGAGGTGGGCTGAGAAGGACCAGAGCGAAGGTCTGCTGTCTGCT
CTCAGTCCTCATTAAGTACCTTCTTCAAAGATGAAGGAAAAGAAGGTGCTCATGTCCTCATCCTGGAAGG
TCCACGGGAAAGACACAGGTAGCTGCCACAGCTTCTCCACAGCCACAATGAGTGATACTGCCTGCCTGAA
GCTCTTGTTGATGTGCTGCTGCGAGATTTGAAGCTGGATGCTCTCATCAGGACAGCCCAGGTCAAAGGTT
TGGAAGCAGCCCTGTGGAGAAACCAGGCAGTGAGCACATCAAGTCATCAGACCAGAGGACTCCTACATCA
ACCCCAGAGAACACCAAGGGCCCGGGAGATAAGTTCTTAACCACAATCCCTGTCTATGTGGAGCCCAGAG
AATTTAATTGGCCTACCCAGGGGTACATGGCAACCAGACACAGGCTTCCTGGCATTCTCTATAGTAAACC
TCATTTCTACTTTATCTTTCTTGTACAGACCTTGCCTCACTGTATAATTAGACCTACTTAAACGTTTCAT
CTTTTGGTATCCTTGCTGCTCAAACATCATGTTATTTAATTTCTCATGACAGTATGTTCATGTTGTCTTC
TATTCAACGGAGATCACCCAACAGGCTCTCAATGGCTTCCCATACATTCTTTTTCTCATAGGAATATTTA
GCAGACACTATAAGCATAGCTTTTGTTTGTAAAATATGTCACCACTTTTCTGTTCTTTGGAGAAACACCA
CATTAAGGCCTAAACACAGTTGCCTTGAGGCATGATAACAGTTTCAAAGCTTGAAGGACAGCGATAGATC
ATTTCAATAGTGTAAAGGAAAGGTTGATTGGGAGAGAAGTTTCTGTCCAGAGTAGAGGCTCCCAGGGAAA
GCCATGTTCTGGAGCAGGCAGTGGGGGACAGAGCCTGGCTGGGAAAGTGAGAGGCGTCACCCAAGGCTGA
ACTAACTAGTTAGAGTGGTCTTAAAATACATTCATGTAAGCTAAGGACTAGATTCTGTAGCTGGGGGAGA
CTGTTGAGGGATTGGGAAGAGGTCTGAGAGAAACAGCTGCCTCCTGAGTGGGGCAGTGACGTGGCTGGAC
TGACGCCATGTGGCATTAGAGCGTTCTCAGTCATCATAGGAAGGGACAGCTGGGATGCAACATGGCTCTT
CATGAGAGCAAGTCTGGAAAGTGCCCTTGTGCTAGGATGGACTTGGCCAGCACTTAAAACACTTCAGAAT
GGAAGGTTGTGACAGATCGCCAACATTTCAGAGATCTTCTGACCTGTGTTTCCCAAAGGACACAGTGGGG
ACTGTCTATGATCACACAGCAATGAAAGGTCTTGTCTAAGGCCACAGGTTATTTTTAAAAATCCTAACTA
ACTTTTTGTTTATATCACTTATTTCTTATTATCTTAATCTCCCCAGGAACATGCGAAACTGTTCTTTGGC
AGAGAAGGAAGAGATGCTAATTCTGAAGGTCATGCTCTCTAGATCCAGAGTTCGATTTAAGTGGTCAGAT
TAAGCTCCATCTCTCTCAAGGGGGGACTAAATGTATGTTGAAGACCATACTGTCTTCTTAGCATAAAACA
CCATGATTGCCATCAGCAAGCCTTGGTGTGTGGCTGTGGTAAATGAAACCTGTGTGGGAGCCAGGTCAGT
GTGTGGGTTGCCTTATCTATGTCACTGAAAGAGGCAAAATAATCCCATCACAAAATAGCCTGGGAGCAAG
GCAGTCCCATATCCCTTCCCGTTTGGGTTTTTTTTTCCCATGCCACAGTCCCTCCACAGGTTAGGAGCCA
AGCTCAGAGTCTCACCTTCATCTTTTGGGGTCCGTCAACTTCAAAGAACAGGTCATTCTCATCACTGTAA
TGAAAACAGATGTGGTCAAGTGATAGCTCCTTATCAATACTGAGCAGACAGACTTCCATTGTTCATAAAA
CCACACCTACCATGACTCTTAAAGCTTCCCAAAGACTTCTGGGAAGTTCTACAGTGCTACGTAAGTAACA
GTCTAGAAGCAGATTCTGGGCCAGGTAAGTGGGTGCTCTGGTTGCTCTCTGTTGACTTCTGACACCTAAA
TTCTAGACTAGCAGAGTTAGCTAAAGTCTGAGCTCTCTGCCTTTGCTTCCAAGCCAGACTTTGCAAAAGA
GTCTCTTATCCTGTCCATGTGGAAGTTTTTCTTACCATTGCATCTGTAGGAGTCCCTGTAGTGACAGCAC
CTAAGTCCCTAGGTTGGGCTTGGGAGTGAAGAGGTCAGTCTTTAAGCTAGGTTGCTTGAACTCTGATAGC
CACTGAAGGAGATGAGTTGGGGACTCTCTGGCCTCTGAAAGTAGATAGCCCTCCATTCCTGAAAGCAGAG
TGCTGGATATGTGACCACTCTCCAGTACCCACTGACCTGTCAAAAGGTGGCATTTCACAGTTGAGTTCAG
GAACAGTTGCCATAGCTGCTTCAGACACCTGTGTGAAGAAAGAAAGTGGGTGGGCATCCAGCGTTAGCTC
CCCGAGGGGCGTCCTTCATATGTGTTTCTCTTAGCTCTAGTTCAGGGCAGGCATGCTAAACTGGTCTCTG
AGGAATGAAGGAACGGAGGAGCCGTTGTATAGGTCTAGAACAGTGGCCCTTTTGGAGTCAAGTGGCCCTT
TCACAGGGGTCACCTAAGACCATTGGATAACACAGATATTTACACTTCATAACAGTAGCAAAATTATAGT
TATGAAGTAGCAATGAAAATAATTTTAGGGTGTGTGGGGGGTCACTACAACATGGGGAACAGCATTAGGA
AGATGCTCTGGAAGGAAGCAACAGCAGAGCCAAACCCTAATAAAGAAGCTTTCCTACAAGACAGGAGCTG
CCTTTTAGATGTCAGCGGCTATACAGACAGTACTCATTTCCAGAGTACTTCACAAACCATGGAGGTACAG
CTACTTTTTATAAATAAAAAGCCCAAAGTCCATCAGTGGGGGGGGGGGAAAGAGAGAGAGAGAGAGAGAC
AGAGAGAGACAGAGAGAGAGACAGAGAGACAGAGAGAGACAGACAGAGAGAGACAGAGACAGACAGAGAG
AGAGAGAGATAGACAGACAGAGACAGAGAGAGAGACAGACAGAGACAGAGAGAGAGAGACAGAGAGAGAG
AGATAGAGAGAGACAGAGAGAGAGAGAGACAGAGAGAGAGAGAGACTTACTTGCACAAGGAAGCTTGGCT
GGAGAGGATCCCAGATGAGCCTATTAGGCCTC
Protein Sequence
>gi|6680415|ref|NP_032387.1| interleukin-1 beta precursor [Mus musculus]
MATVPELNCEMPPFDSDENDLFFEVDGPQKMKGCFQTFDLGCPDESIQLQISQQHINKSFRQAVSLIVAV
EKLWQLPVSFPWTFQDEDMSTFFSFIFEEEPILCDSWDDDDNLLVCDVPIRQLHYRLRDEQQKSLVLSDP
YELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKK
KMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Molecule Role Vaximmutor
Related Vaccines(s) Bacille Calmette-Guérin (BCG) , Francisella tularensis galU mutant vaccine , Francisella tularensis guaB mutant vaccine
References