VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IFNG

Gene Name IFNG
Sequence Strain (Species/Organism) Bos taurus
NCBI Gene ID 281237
NCBI Protein GI 31982949
Locus Tag BOS_5228
Genbank Accession AF140653
Protein Accession NP_776511
Taxonomy ID 9913
Chromosome No 5
Gene Starting Position 45830157
Gene Ending Position 45834980
Gene Strand (Orientation) +
Protein Name interferon, gamma
Protein pI 10.24
Protein Weight 18866.5
Protein Length 166
DNA Sequence
>gi|258513362:45830157-45834980 Bos taurus breed Hereford chromosome 5, Bos_taurus_UMD_3.1, whole genome shotgun sequence
AATTAGAAAAGAAAGATCAGCTACCTCCTTGGGACCTGATCATAACACAGGAGCTACCGATTTCAACTAC
TCCGGCCTAACTCTCTCCTAAACAATGAAATATACAAGCTATTTCTTAGCTTTACTGCTCTGTGGGCTTT
TGGGTTTTTCTGGTTCTTATGGCCAGGGCCAATTTTTTAGAGAAATAGAAAACTTAAAGGAGTATTTTGT
AAGTATGATCTTTTAATGAGACTTTCTTGTGATTGAAATGACTTGATGTTTGATGTTGACTTGGAATTCT
ATCTATGATGGGCTCTCATCTCTAGTCTTCAGTCATTTTGAGAAGACTTGCTGTTATTGTGACTGTTAGC
TAGATGTGTTTGTTTGTTTGGTTTTTTTTTTTTTTCTGACTAAACAATCTCTGCTCAGTTTGCTATAGAG
ATTTAGAAGGGATTCATGAATCTTTCAAAAGATGGGCATAATATGTGTATACATCATAGTGTTGATATTT
TGTGATAAGAATCCATTCAACTATGATGTTAAGTAGCAAGCATACTGAAAAGACAGCTGAGTCTTAATTT
TTGATTTCTCATGTTACTATAATGATGACAGTCAGAAGTCAAGATCAGCATTAAAAATGGTCATTTGACA
TAATTGATCAATTAAAGAAGATGAGGTCCTTAAATATTTGGCTTAAAAACAAAAACACTTATAGGTGTTT
TTCTCTAAAAAGTCATTTTAAAATTTTACTATCCCATCTAGATTGTCTGTGAATTACTCTTGGACTCAGT
CACTTGCTGAGATTTTTTTTGTAGGAGTTATAATCTAGTTTATATTTTAAAAAATTTTTTGTCTTGTTTT
AGGAATTTCTTAAAAATTTACTTATGGTTAATTAAAATAGCTTGGGCATTTTAAATATTTTATCATATAT
CCAAATTTAGCTGTTATAATTATAGCTGGAGCTATCTTTTAAAGGCGATATAATACCTTATAGGAGGACA
CAGGTAGAGGTTATGAACCGTATACCATAGGGGGGCAGTATTTTATAGTGAGATGATGTTGTTGATTTTT
TTTTTTTTTTTAACTATACCTTTTTCTTACCATAGTAATTTGGGACAGTTGAAGTATCATCAGTCTTGAA
TGAGTTCATTGTGATGTTATATTAGTAAATAAGAAAGCAAAAATCACATGATAGTCTTTGGCTGTTATCC
AACCAGGTAGCTTTTGTGAATATTTTTTGTTAAAACTAAACAGTGTTGAAAAGAAAATCAGTAAATAGTG
CCAGCATCCAAGTTCAATAAAACTTGAGGTACATTTTTACAGCAATTTATGGACTAATTTTAAGCCAATT
TTTTATTGTGTTGTTTTATTTTCCAGAATGCAAGTAGCCCAGATGTAGCTAAGGGTGGGCCTCTCTTCTC
AGAAATTTTGAAGAATTGGAAAGATGTAAGCTGAACATTTCCATTTGGCTGATTTTCCTGTTGCTTTTTT
TCTGATGGATAAATTCACATCAACCTCTCTTTGTGCTCTTTTCTCCCAAGGAAAGTGACAAAAAAATTAT
TCAGAGCCAAATTGTCTCCTTCTACTTCAAACTCTTTGAAAACCTCAAAGATAACCAGGTCATTCAAAGG
AGCATGGATATCATCAAGCAAGACATGTTTCAGAAGTTCTTGAATGGCAGCTCTGAGAAACTGGAGGACT
TCAAAAAGCTGATTCAAATTCCGGTGAGATGATCTTAATGCTTTCTTTGGTATCATTGCAGAGGCTCTTA
CAAAGCACTTCATTCCCAGAAAATAGAAATTAGATACCAGGTGTAAAGCTCTGAAGTGAACTTGTGGTCA
AAATGCCTCTTTGCTAGTTCTCTTTTGACTTGGGTGACTTTGCCGAGTCAGTTATTGGAGGCACTTAAGT
CTGTGATTTTGGGAAAATACTGGCATTATGCCTATCGCACAAAGATGGGTGAATGGACAAATCAGTGAGG
AGGAAGCAGAGAAGGAGTTGGGGTGATGGGGACAGAGTACTGAAAACCAGTTCTCCCATTGCCCCTTGTC
TGTGTGTTGGAAATTCTCTTGCTTTGAATAGGTTGCATGTCTTAATGGAAAGAGCAGTGGGAGGGAAAGG
GAAGAAGATGTGTGCTCCGCCCAGCTTAGCCACCAAAGAAATGTGTGACTTCAGATGAATCACAGGCCTG
GCTGGGGCTGTTTCCTCATCTTAAAAGGAGCCTGTTGAGTTCACTGTAATTTCTACGGTCTCCTTTGCTC
TAAAATTCTACAATGCCATGGAAAGAAAATGAGAATGAGATAGGAGAAAGGAATAGCCTTTGAGGAGACA
AAGGCCCTCCCACTGTCGAACTCTGGTCAATCACCCAGATTGTATAGCCCAAGGAGAGGTGACTGCGTTT
GTTTTTAGAAAGAAAATAGGTAGAATTGTCCTATCAATGAATTTTTAAAGTTTTTAGAAGCTGAAAGATC
ACTTTGAAGCATAAGGACAAGTCACATTTTCCAAAATTTCACCTAAGGGACAACGGTCTCCAGATTTTTT
TGCGGGGGAGAGTTGGCTTTTGTATAAATAGGCTTGGGTGAGAAGAGGAGGGGTCCCATTATGACTTGTG
CTTTCAGGATTTGTACCAGCTCTTGCTCTAACCTGGTCTGCCTCTCAACAATCTCATATAAGCTCCCAGG
AACTGAAATAAGTGGTTGCTCTTCAAGATTTCTCTAGTCTCCCATATATTAGATGGTATGAGAGTGGCTT
GGAAAAATTATATGTAATGTTTTCCATGTTCAGCAGATCTCCATTGGTTGCAGGCTAGAGAATGAAAAGG
CACTGTTCCTGACCCAGTGCTGCCTCTGGTTGCTGTTCAGTCCTAGAGAAGTCCCTTAGTTTCTTGGTGA
TGCTTAGAAAACTGGAAAGTTATCACTTGTAAACACACAGCTGGTAGAAATTTTTCTACTCTGTTGTAAC
TGGGCCTTGAAAACAATAGGTTGGTCCCATCCTTCTGGAAGCTCCAAGCCTCCTTCTTCACAATGTGCAA
TCTTGAGTGAGTGCTCAACCATTGTCGTCTTTTGCTCAAATGTGAACATATTTAAGGCACGTTTTGCCTT
TTTGTCTTGTAACTTAGAATCTCCTAGTCATTCTCAGAAATGTGGCAAGGTGGCTGCAGTGTTTCAGCTT
TAGAAAGAAATGTAGTGGCAGAGCAAAGATGAAAGCAAATGGTCCTCATTTTATGAAGCATGAATTCACC
TATATTGTCCTACTGGGAAGAGTGAGAAAATAGTTCAATTTGCTGGAGTGGAAGGCAGGGTACCGGGAGA
TTGCTTTCATTTCTAACTTTATTATATAATACCAGTAATTGATTACTACCTTTAAATAAGATCCGTGTTT
ATTTTTAATCCCATCATGGAAACAATGAGACTGACCTAATTTGGAGGAAATTAAAAATAATGGTTTTCCT
CCTTCTAGAACTTGGTGTTTATAAAGTACTGAACCTATACCAATGGTTTTCAAACTTGGGTGGTGCCTAA
ATCACCTGGTGATGTTGGTAACCACACAATGGCCCAGGCCTAGTCCGATTTCACCCATCTGGGTGTCAGA
GTTCTTCATTAGGTCCTCAGGTTACTCTTTTACGCACCAAACATGAGAGCCATTGGCTATAGTAACTCAT
TTGATGCTTACAGCGAAGACTAAGTACTAAGTGATAGCAGTGACGGAGACCCTAGGGATCATCTAAACAC
TCTCCTCATACTTAGTGGAGAAAACAGAGATCTGGAGAGCCTCAGTGACTGGTTTAAAGTCAGATGTATT
GCACACACAGAATTCACACCCACATTTTTCTGTCACTCTACTTCTGGGGTTTTTTCACTATATAATTTTC
AGATCTCTGAAGTGGTAAATTTATGAATATGTGATGTGCTCCATCCTGTTACAGTACAACTATCAATTGA
ATTGTTATAATTTTAGTTTTTATCACTGAAGAAACCAACATTACATATTAAGGTTCATTACTGCTAGTGA
AAATAATTTGTTTTAAAGAATACTTTGATTTTCTTGGGCCTAGACAGCAGAATATCCTAATGACTCATAG
GCCTGAAATTAATTTTGCTGTTTTCTTTCCCAATAGGTGGATGATCTGCAGATCCAGCGCAAAGCCATAA
ATGAACTCATCAAAGTGATGAATGACCTGTCACCAAAATCTAACCTCAGAAAGCGGAAGAGAAGTCAGAA
TCTCTTTCGAGGCCGGAGAGCATCAATGTAATGGTCCTCCTGCCTGCAATATTTGAATTTTTAAATCTAA
ATCTATTTATTAATATTTAATATTTTACATTATTTATATGGGGGATATATATTTAGACATCAAAGTATTT
ATAATAGTAACTTTTATGTCATGAAAATGAGTATCTATTAATATATGTGTTATTTATAATTCCTGTATCC
TGTGACTATTTCACTTGACCCTTTTTTTTCTGAGTAACTAGGCAAGTCTATGGGATTTCAAGGTTTTATC
TCAGGGGCCAACTAGGCAGCTAACCTAAGCAAGAATCTGTGGGTTGTGCACTTATTTCACTTGATGATGT
AATGAATGCTGATAAATGAAATGATGCCATCTAGTCACTACTTATCTGAGACTAGATCTGGATTCTGAGC
CACTACTTTGATGGCATGTCAGACAGCACTTGAATGTGTCAGGCTATATGACTTGTGCCCTGACAAAAAC
ATAGCATCTCATCTCACCTTATACCTGGCGCTTCAGGATATCACTGACAATTGTGATTACACCCAAATGG
AAAGTAATATGTTTGTTTAGTTTATCAATATTTAATATATATGAATAAAGTATAATTTCATAAC
Protein Sequence
>gi|31982949|ref|NP_776511.1| interferon gamma precursor [Bos taurus]
MKYTSYFLALLLCGLLGFSGSYGQGQFFREIENLKEYFNASSPDVAKGGPLFSEILKNWKDESDKKIIQS
QIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQIPVDDLQIQRKAINELIKVM
NDLSPKSNLRKRKRSQNLFRGRRAST
Molecule Role Vaximmutor
Related Vaccines(s) Bacille Calmette-Guérin (BCG) , Mycobacterium avium relA mutant vaccine
References