VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IL17A

Gene Name IL17A
Sequence Strain (Species/Organism) Bos taurus
NCBI Gene ID 282863
NCBI Protein GI 56605852
Locus Tag BOS_21471
Genbank Accession AF166487
Protein Accession NP_001008412
Taxonomy ID 9913
Chromosome No 23
Gene Starting Position 24346987
Gene Ending Position 24350508
Gene Strand (Orientation) +
Protein Name interleukin 17A
Protein pI 9.15
Protein Weight 15852.85
Protein Length 153
Protein Note Also known as IL17; IL-17
DNA Sequence
>gi|258513344:24346987-24350508 Bos taurus breed Hereford chromosome 23, Bos_taurus_UMD_3.1, whole genome shotgun sequence
TGTCCATCTCACAGCGAGCACAAGTTCATCTGTCTACAGTGAACTGGAAGGAACTACCATGGCTTCTATG
AGAACTTCATCTATGGTGAGTCCTGAACTGATGTGTGATTCTCTTCTCGATTTAGGCCAGATCAATTTCT
GGACTGCGGGCATGAAATTCTGGATTCTAACTATGGAAATACAGTCTATATAGGATGGGAAATGAAACCC
TTGATAGATATTTGTCATTATTGAGCATTTTCAAGAACTGGTGCATATCAGTTTGAAAGATGAGATTAAA
ACTGAAAGATAGCTAGACTGGGGCTAAACCACACAAGAAGTGTCAACGTGACATTGTGCTGTAAGAGAGA
ATGCTTATTGAAAATCTGTTTCTCTGGGTACAAGGGATTTAATATAATTCTTCCACAGTGTTTTTCTTTA
ATTCAAAATAAGATGGGTCACTACCCTTGAAGATTTAATGTTTTGGCAGTGACTCTTCTTTCCATTATTG
TATTATTATACTATAGTCTTGGTACACTAACCCTATTTTCTTAGGTATGTTTCCCAGCTTTTCCAAATTT
ACATATATTGATTCTGTAATCAAATTGGATTTCAAAAAAGATGCTTTAACAATATTTTAAAAACAGAGAC
CTTTTAATTCTAATCTAAAGTTATACATGCGTCTTTTTTGAAACCCAATTTGATTACAGAATCAATATAT
GTAAATTTAGAAAAACTGGGAAATATACTTAAGAAAATATAAGAGGGTGTTGAGTTTGGGCTTGGACATT
TGCCAGTGGTACCAACAGAATTTCTAACTGATTCCACATGGATTTTATACAGCCCTTTATGTCTAAGGTG
TGCATTCCCTTTTATGCAATGTTTCACAAAATGTAAGAGGAGATATCAATGGTGTAGAAGGGCATTTCTT
CCTAGAAAATCAAGGTCATTACCCTTCCAAAGACCTGAGAGTGATGCATATACTGATATATTGATGACTT
GCCATCTTCACTAAAATTACTGTCAGCCAATGAATAATGTGGTTTTTCTACTTTAAAAAAAAATGTTCAA
GACTGGTAGAAATGCCATGGTCCTAATGTCACTTTAGTCATCTCATCAGCTTTTCACTTAACATATTTGA
AAATTTAGTATAGATTGTCCTGGACCATAGAATGTTCTCTACTATCAGCAATTTAATCATTACCACAGTG
TGTTAACAAAAACCATTGTAGTACTAACCCAATCTACCTCTCTCTCCATCCAGTCACTGCTACTGCTTCT
GAGTCTGGTGGCTCTTGTGAAGGCAGGAGTCATCATCCCACAGAGTCCAGGCTGCCCACCTACTGAGGAC
AAGAACTTCCCGCAGCATGTGAGGGTCAACCTAAACATCGTTAACCGGAGCACAAACTCCAGAAGGCCCA
CCGATTATCACAAGCGCTCCACCTCACCTTGGACTCTCCAGTACGTAAGCACCCCAGATAAAACCTCTGC
ATTCTTCTACATCAGAAGAACACATCAGACTGCCAGTTAAATCATCTGAGGGGGGTGATATTACTCATTC
AGAATCACCTGTCAAACCTGGAAGAGCCATTGTTCAAACTAGTGATTCTCCAATTTTCTTTCTACAGATT
TCTTTCATAGATCACAGCTCTCCCCAGCCCATCCATAACACCTAGCCTACGAGTTCTCGATGTCCCCAGA
ATCCACTTAAATGAATGGTGGTCATCATTCTGATATTTATGACACCCCAAGTCTATTGTTTATTTACCCA
AAAAAGAAACAGACATTTAGCATGGGAGATTAGTACTGGAATTCTCTTTCCCAGGGCTACCAGAGAATAC
CCTGGTAGAGTTTGTTGACAACAACAATCAATTAACTGGGATTTTTGTGCTTTTCTTGGTTATATTAGCA
CTGGGAAAAGTGGATTAGCTACTGGATTAGCTTGAATCCCAGTAGAAGAAGTGTTCCATTGGGTGTTTCA
CCGTTTTTTGACTTAGTCTTGAATTACATCCCCAACAGACTGACATTCGCTGTGTCTTTAATACATCTAG
TGGTGGTGGTGGTGGTGGTGGTTTAGTCGCTAAGTCGTGTCCGATTCTTGTGATCCCATGGACTGTAGCC
CACCAGGCTCCCCTTTAGACCCTATGATGGATCAAATACAAAATGCATTTTGATAATTTGATTTCAGGCA
AATGATCTCAGTTATGTGGAGCCTACAGATTCACTTGTCTATAGGGTCTTTTCTTCTTACTTACTTACTT
ACCAAGAATAGTTCAAATAACTTAAACTAAGTCCAATCACTCTCTCAGCCAGAGGAGAGGGAGAAGGGAA
AGTTACAGAGGGGCTTCAGATATTGTTTCCAGCCCTTCCTGTCACCCGTGGGCTCTGCTCCATCAGTGTG
TTGTCAGATAAATTTGGATGCCTTTCTTGTTTCAAAGACAGACTTCATTAAGTCAGATTAGCAGCTATCT
TGTTTCTAGATGACTCTTAGTTTTTTTAATCTATCAAATGCACCCTAAAAAAATATCCTTTATGACAAAC
AAATCCTTTCTGTAGTTTCAGTCTGTCTTCTTTTGTTTATTCTTCAAAGAACCTGGGGAAAGCTGATCAT
TGTTTCTTTTTTCTGTAACATTTCATGGGCTTCCAAATCCAAGTTTTTCCCAAATGGCTTGTTTTCCAGA
CTAATAGCACTTAGAGAATTTGCAATGCCTATCATGTCAATTTGCCTCCCTTTGCTTATTCCTGTTTGAT
TTCCTTACTGCTCTACCAGGAATTCACTTTCTTCCTGGCTTTTGTCTCCCCTGCAGCCGCAATGAGGACC
CTGAGAGGTACCCCTCTGTGATCTGGGAGGCCAAGTGCAGCCACTCAGGCTGTATCAATGCTGAAGGCAA
GGTGGACCATCACATGAACTCTGTCACCATCCAGCAAGAGATCCTGGTCCTCCGAAGGGAGTCTCAGCAC
TGCCCTCACTCCTTCCGGCTGGAGAAGATGCTGGTGGCCGTGGGCTGCACCTGCGTCACCCCCATTGTCC
GCCATTTGGCTTAAGAGCTTTCTGCCTGACCCCTACTCCCCAAATTAGTTAGGTTTCCTGGGGAGTAGGC
CCAGCCCCTTTTCTAACTAACATCATTTATGTATTTAATAAGCCCTGAAATAACTTTGGGGCATAAGATT
CCACTTTGATGTATTACATGCTTTATTTTCTATTCTTTTAAGACAAGTTTCCAGATTTGTGAATATTATT
ATTTAAAAGGTAGAACCTATATTTATATGAGCTATTTATGGATCTATTTATGTTTCATTAGTCTTTAGAA
AAAAGGTGAAATATATGAGTATCTGTTTTGCCTAGGGAAATCCTAGATAGGATTAAATAGCAGTTGAAAA
TGTCTGAGCTTGTACTACATATGGCTATAGAATTTTCTCTTGCTTGTCTCTTTGGAGTACATAACACAGC
TGAAAAGAGACTAAATTTAGTTTCATATTTATTAACTTAATTTTGTAAATTATTGAGGCATTACAAGAGA
GACAGCAAGTCTAACTGCTCTA
Protein Sequence
>gi|56605852|ref|NP_001008412.1| interleukin-17A precursor [Bos taurus]
MASMRTSSMSLLLLLSLVALVKAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTS
PWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAV
GCTCVTPIVRHLA
Molecule Role Vaximmutor
Related Vaccines(s) Mycobacterium avium relA mutant vaccine , YF-Vax
References