VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IL22

Gene Name IL22
Sequence Strain (Species/Organism) Bos taurus
NCBI Gene ID 507778
NCBI Protein GI 148356272
Locus Tag BOS_5234
Genbank Accession EF560595
Protein Accession NP_001091849
Taxonomy ID 9913
Chromosome No 5
Gene Starting Position 45721766
Gene Ending Position 45727534
Gene Strand (Orientation) +
Protein Name interleukin 22
Protein pI 9.05
Protein Weight 20001.55
Protein Length 190
Protein Note Also known as IL-22
DNA Sequence
>gi|258513362:45721766-45727534 Bos taurus breed Hereford chromosome 5, Bos_taurus_UMD_3.1, whole genome shotgun sequence
CACAAGCAGAAGCCTCGATACAGGTAAGTCCTCCAACGAACTTGGTAGGATTGGCTTGCTGGGTCTATTC
CTTCTGGATACTTAATTTTTTCCCTTAATGTTGATTTTGTTTCTCGTTCTCTTGATACCAGGTTCTTCTT
CCCTAGTCACCCATTGCTCAGGTTTGCTTTGTCCACGATGGCTGCCCTGCAGAAATCTGTGGGCTCTCCT
CTCAGGGACACTCTGGCCGCTGGCTGCCTCCTTGTCATGGTGCTGTGCGCCCAGAGAGGAGCGGCTGCAC
CCATCACGTCGCACTGTAGGCTCAACGAGTCCGACTTCCAGGAGCCCTACATCTTCAACCACACCTTCAC
TCTGGCTCAGAAGGTACTCATCTCAGTCTTTCTCTTTTGCATCTTATCTACTTGGAACCTGAATAGTTCT
TAAAATTTCTTCAGAGGACATCTAAGATCTTTAACAGATGAACATTAATCGCTGCTGGTATACCTGTCAT
CATTTTCTATGTCTCTTTTAAGACTTTTTGGAGATCAAGCTTTACCTCAAGCCCTTCCATTTGCCCGTTA
GGAAATGTACATTCAGTTTTACCCCCAAAGGGGCCATGTAGTAACCCATCTGACTGTTTATGGTTCCCTT
TACTTCTCTAAGCATTCTTTTAGTTTTTGAAGAGAAAGAAATTGACATTTTTGAGCACTTACTATGTTAT
GAGCTCTATTCTAGGAGCTTTAAATCCATTCTTTCTTTTTTACTGAAGTATAGTTCATTGACAGTATTAT
TTAAGTTCCAGGTATACAGCATAGTGATCCACAATTTTTAAAGATTATTCTCCATTTATAGTTATTATAA
CATATTGGCTATATTACCTATGCTGTACATTATACTGTTCTATCTTATTTTTTAAATTTATTTTGAAGTA
TAGCTGGTTTACAGGGTCATGTTAGTTTCCAGTGTACAGCACGCTGATTCAGGTCTATATATATATATAA
ATATACGTACATATGTGTATATATAATATATGCATATTCTTTTATATATTATTTCCCCTTATTGGTTATT
ATAAAATATTGAGTATAGTTCCCTGTACTATTTAGTAACTTCTTATTAGTTGTCTATTTTATACATTGTA
GTGTATATATGTTACTCCCAAACTTCTAATTTATCCCTCCCCTCAACCCCTGAGCATCATTTTAAACCCA
TGCACTAAAGAATCCTTTCTTTAGTCTTCACAGTGCTGCTCTGGGAAGAGGGGACAGAGTACAGCTTTGC
TTACAGACATTTCTTCTAGCTTTATGATGTCCAGGCACTTAGTCTTTTCTTTTCTTCTAGGCTAGTTTGG
CAGATAACATCACAGATGTTCGTCTCATTGGGAACAAATTGTTCCACGGAATCCATGTAAGCCATAGGCA
TGATGCCACTTGTGGTTACTTGGAGTGGTGGTGAGGATGGGCTGGGTCTTGTGGATGTCGCCTAATTTGA
GCCCTGCTGTTTCACTTTCACCAGCAGGTGACGAAGCGCTGCTACGTGCTGAAGCAGGTGCTGAACTTTA
TTCTTGAAGAGGTGCTGTTCCCCCAATCTGACAAATTCCACCCCTATATGGAAAAGGTGGTGCCCTTCTT
CTCCAGGCTCAGCAAAAAGCTAAGCCAATGTGTAAGTTCTTCTCCAGCCTGAGTCCAATCCTCCCAGTGC
CTGCCTTTCCTCTTTCTTCTGTGTAGAACCCTCTTCCTTCCCACCCCAGTGCCCCTTCCATGCTGGTAGT
GAGAGGTGCCTCTGTCACACCATTACAGAAATCATTTGGCATCACAACCTGTTTGCTTTTGCTTTAACTG
AGTCACATTTTGAGTTGATTGTGATGGGCAGGGTCTGATAGACCACAGGAGGCTCATTTGTCCCTGGGAA
AAAGCGATTTGGACTCTGTGAGATGAGAAAGGTGTTGGGAGCTGTAAGGAAAAATACCTATTGGTGCAAA
TGGATTCACTGAATATAAGTTGATGGAGGGAGGGGATGGGAAAGAGAGAAAGGGAGAAACAAGATTTAAT
ATTCGGCAGTGGGTGGGTGGATGAAGACTGCTGCCCTTTTGATAATGGAAGTGACAAAATCAGAGGTGCA
TGAGTTTGATGCCTCTGAATATTGAAAACTAAGAAAAATATTTTGGTGGAGTAGGCTGAGCAAAAGGGGC
CTACTATTTATTGAGGAGGGCCCTGTTCACATAAGATGTTTTATGTAGGTTTCTTGTTCTGAGCCCATGT
TTTTGATGAGGTGCCGTTATGGTTTTATTCTTGACAGGATTTGCATAAACCACTCCGCTCTTTCCACAAA
CTTCAACCTCATTAGGGTTGCCCAGAGGTGAAGTGAGGTCCCGTGTAAGGGAAATGACTGGATTTTGGTG
TCCCAGGGAATTGAAGAGGTCAGAAAATCTAGGTCACTATTGATATCTAGGTCATTGTGGGCAAAATTGC
TAAGAACTTTAATTCCAGATGAATTGTAACATACTTCAGTTAGGAAGGCTGAGTTTCAAAATCTTCAGTA
CAACAATGTTAAACTTGTTACTCTCATTTCCATTTTGTAGCATGTTGAGTCTGACAACCAGCACATCCAG
AGAAATGTACAGAATCTGAAGAACACAGTGAAAAAGGTACTACTAACAACTATTAGTACTAAATCATTTG
ATAGAAGAGACAAATATTGTTTTTCTTCCCTTTCTTTCCTTTTTTCTCCCACGTCATGATTTTTTACTTG
ACTCTCCTGCCATTGGGTTGATTATTCAGGTGCACATTAAGTATAGATGTGTCTATGCTATGCTATGCTA
AGTCACTTCAGTCGTGTCCGACTCTGTGTGACCCCCCAGACGGCAGCCCACCAGGCTCCCCCATCCCTGG
GATTCTCCAGGCAAGAACACTGGAGTGGGTTACCATTTCCTTCTCCAATGCATGAAAGTGAAAAGTGAAA
GTGAAGTCGCTCAGTCGAGTCCGACTCTTAGCGACCCCATGGACTGCAGCCTACCAGGCTCCTCCATCCA
TGGGATTTTCCAGGCAAGAGTACTGAAGTGGGGTGCCATTGCCTTCTCCGTAGATGTGTCTACATGTTTA
TAAGTCAGTTTCCAAATTTTGCAAATTCTAGAACTGGCTGGGAACTTAAGACATTGACTTATTGTCACCC
ATGTGCTAGGGATGGCCAGTGTCAGAGTCAGAATAGACTGCAGGACCTCTGAATCCCATCCAGGCCAGAA
GTGCTGGATATTATACTTAGTCTCATTAGTTCTTAGGGAAATTTTAGATACCTACTGATTCATTTAGTCT
GAAGAAGCATTTGTTCAAAACCCAAAACTGGGTAAAACTTATTTGAAAGAATTTTGAAGTCATTCACATG
ATGATGTAAAACTTGAGAAATATACCTAGAACAGCCATAATAAAAGAGCTGGACTTTCACATAGGATGAA
TTTCTGGAATGGTTTGATACTTATATTTAACTATTAAAATACCCAGCAGCTATTGGTTTTAATTTAAAAG
TGAGAGTGAATGTCCCCCCAGTCTCTTTTACACAGTATCAAATAGAATAGAAATATTACTATTAGTAATG
GATTCATTGTAGGGAAATGAATGTCCACACCGGAAGCCCTCTTTCTTCCTCTTTCCTTTTCCTTCTTTCC
TGGTCTATTCTTTCCCTTGACAATGTGCTAATGAGCATCTATCTGATATAGTTTAGTGTATATTTTGACA
GAGAATGATATTGTCGGGTGGCCTATTTGGGGGGAAAGAACAACAGGGGAAGGCTCAGCTCAGCTGCTGT
GACTCATCCAAAAACCAGAGCTACCATGAGCAGCAGCAAAAGTGAGGATTTGGTAGGCAGGTACAATTAA
ACCTCAGAAACAAGAATGCTCTGGTTGATGGAATTTTCAGTAACAAGCATAACCTCAATTCCCCCTTTTT
TCCATCTTGATTTTTTAAATAAAAAGTATCTCTTCCTGAATGTGATTTAATGAACATTGTCAATGTCTTC
CTTTGATAACTTAAGGATTTGTTTTTTTCATTGTGAAGATAAATTCTCTTGTCATAGAACGATTAGCTAG
ACACAGAGGGCTGAATATTAGCATGCCATAGCCAAGAAGTACTTTGCATTTCTGGTGTGAAAAATTCCTC
ATATGAGCTTACTTTGTTGTCTTTAGAAAAGTGGAGTGTGGGAGACAAAAAGCTGATGGTGATTTGTGTG
GGAAAACAGATTTTAAAGCTCTTAATCCATTTTGAAGGAATTGACTTACACATTAGCAATCAGTTGCCAT
GTGGATGAGTTGTTATGCTTTTTTTTTTTTTTTACCCTGTAGTTTCAGAAAGCCTAGTGAGAGAGGAATA
TTATTTAGAGAAATCTCAGCATGCGTAAACACTGGTCAGCACTATGAAATGGGAGGGCATCTTGGGGGGA
TAGTAATCCCTTGTCACTGAAGAAAAGTAGAAAGCAGGCTGTAGCAGAACAGAGAACAGATAGTAGAATT
GTTTATCATCTTGGGAGTCTTTGAGATATTAAAAAAATATCTCTTGTCGTTATGTCAAAGGAAGTATCGA
AAGGTGGAAAGATGGAAGAAAGCAGGAAGAGAAAGACCAAAGTCTAGAGGACAATGATGACTTAGGGTTG
CTGTTTTCTTTGAAATAATCTTGAGCACATTTAATAGATTAGACAAGTTTCAGAGGAGGGGATTTAGACT
TGTGTTCCCTCTCCCATGGGGTTTAAAAGACTTTTGCCTACTACTTGGAAGGAGGAGGAAAGAAAGGGTG
TTAGACTGTATCTGGCCTTTCACTGTTAAAGCAACTAGATAGGAGACATTTGATATTTCCCCCACAAAAG
TGAAAACTTGTTTTCCCCACCTTGGTCAAGAAAGTGGAAACAGAAATAGTCCACATGTTTTGGTACATGT
GGTAGTTTTGGTTCAAGACTATTGGAGTTGAGTGGTTATACTAACTGATTGGTCACAGCAGTCATGGGAC
TCAGAGGCAGGGCAAGGAGGGGTGAGTGGTGCTTGGGTCCCCCAGATCCCCCAACAGCCTCTACCTGCTT
GCTCTGGTTCAGCAGTGATTTAACACATCAACCAGCTGAGACTGATGCCCATAGGTGCCCTCTCAGATCA
GGTCATATATTTTGAAAAAGGGTATTATCACTAATCTTTTATAAAATGTTAAAACTTGGTTTCTGTTCCA
ACAACCTAACCATCTCATCTCTCTCTAATTTGTTTCTCTTTAGAAAACATGGTATAAATGCTGAAATACT
TGTGTGTTCTTATTTTCACAGCTTGGAGAGAGTGGAGAGATTAAAGTCATTGGAGAACTGAACTTGCTGT
TTACAACCCTGAAACGTGAATGTGCTCAAGTAGACCAAGGCTGGAAAATGGGTTACTAACCTTTCTCACC
TGCTAAACAATAAGATCCCCTGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAAAAAAGATTACT
TTCTATCTCTTTAGAAAAAGCCCCTAAATAACTTCATTTCCATAATCAATACTTTATATTTATGAATTAA
TTTATTGTTATAAGTACATGTCTTATTATTTATGTCACTTTATAATATGGGTTTATTTATGGAAGCATTA
TAAAATATTTCTACTTAATTATAAGGTGAATAGTAATATTTATGATAATAATTATGGAGTTATGTTTATT
TAGTCTCAATAAACACATCGATATCCTAA
Protein Sequence
>gi|148356272|ref|NP_001091849.1| interleukin-22 precursor [Bos taurus]
MAALQKSVGSPLRDTLAAGCLLVMVLCAQRGAAAPITSHCRLNESDFQEPYIFNHTFTLAQKASLADNIT
DVRLIGNKLFHGIHQVTKRCYVLKQVLNFILEEVLFPQSDKFHPYMEKVVPFFSRLSKKLSQCHVESDNQ
HIQRNVQNLKNTVKKLGESGEIKVIGELNLLFTTLKRECAQVDQGWKMGY
Molecule Role Vaximmutor
Related Vaccines(s) Mycobacterium avium relA mutant vaccine
References