VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IL10

Gene Name IL10
Sequence Strain (Species/Organism) Bos taurus
NCBI Gene ID 281246
NCBI Protein GI 41386772
Locus Tag BOS_15514
Genbank Accession GJ062448
Protein Accession NP_776513
Taxonomy ID 9913
Chromosome No 16
Gene Starting Position 4402473
Gene Ending Position 4406411
Gene Strand (Orientation) -
Protein Name interleukin 10
Protein pI 8.14
Protein Weight 19616.38
Protein Length 178
DNA Sequence
>gi|258513351:4402473-4406411 Bos taurus breed Hereford chromosome 16, Bos_taurus_UMD_3.1, whole genome shotgun sequence
AAATAGCTCACAGAGAAGCTCAGTAAATAAATATATGTGGGAGCTGAGGTATCAGAGGTAATAAATACTC
TAGGGGAGAGGCACAGTACAGGTCTCCAGGGAGCTGGCTCTGCTCTCCCAGAACCCTGGATTGGATTTCA
GAGGTCTTCCGTTTACGTCATGGAGTCTAGTAGAGTCACCATCCTGGAGGTCTTCTTCCCTAGAATGCTT
CACTTTTGCATCTTCGTTGTCATGTAGGTTTCTATGTAGTTGATGAAGATGTCAAACTCACTCATGGCTT
TGTAGACACCCCTCTCTTGGAGCTGTGTGGGGAGACAAGACGTGTTCAGTGAAAACTCCCTCTGAGCAAG
TGAGTGGGTCCCTGCTGGGAAGGTCATGACCCTGGGCCCAGAGGCTGCACTAGCTTGCTTGCATTGGGAG
ATGAAGGACAGACTCTGGGCATCTGGAGAGATGCCGGACTGTCAGCAAAGGCTATGCGTTGCCCTGGACC
TTGCCCGGTGGGCAGCAAGAGGAACATTCACTTTGCAAAGTGTGGTTTTTCGAACGGTGCTTTTCCAGCA
ATTTTAAACGTCATGTGCTCACGTGACGCTTATTCAATATCTGATGAAAACACATTAGCGGAACCACTTT
GAAAGAAAGACAATGAGAGAGAGAGAGAGAGGTAGCCTTGTTCCTGTTTATGTTCCCCCACCCGTGGAGT
GAGCAGGCCCAGCCCCGCTGCTCTGACCTACTGCAGGGAGGTTCATGGCCCCTGATACTGGAACCTGCCC
AGGGTCTGTCCCCCACCCACGAGGAGGACATAGGTTCCGCGGCTTCTGGAAAATGGGGTAGAAGAGCTCA
TGGACAGCTGGAAGTGAGAAAGGCCACTTCGTTTGAGAGCTGAGATTCTCAGGTGCCTTGTGTGGTGAGG
CTGGCGGGTGGAAAGAGAGGGGTCAAGTCAGGTAAGGAGAGCTCTGCTTCCTGCTCTGGGCTCGGGGTGC
TCAGGCTGCGCCCCTGGGTGTGTTTGTAAGTGCACGTTCACGTGTCAGCTTCCTGCACGTGCGGCTTCAG
ACTGGATCCCAACAAGCTACTTTCTGTTTCCTCTGTCACTCTCCCCAGCACCCCGCTCGCTGTGTTCACA
GCTGGCGGGCCAGCCCAACCGGCAGGCCTGCGAAGGCAGGGAGCAGTCATTTAGAAACCCCCAAAGACAC
TTCACAGAAAACAAATATAACTGAGGTGGCGGCCCCTCACTGGATGAAGAGGTCACCCCACTTGCCGGGT
TCCCACACTCCCTCCGAGCAAAGTTCAGGGCCTGCTGAGCACCTGCCCACCTCTGCCCCTTCGAGAGTGG
ATGGAGGTCACGGTCCTCAGGCCCTCCCTGCCAGCAGCCCAGCCTCACCTCACTGAAGACTCTCTTCACC
TTCTCCACCGCCTTGCTCTTGTTTTCGCAGGGCAGAAAGCGATGCTGTGGAAAAGGAGAGAGTATGAGCA
ACATTGGTGGCTGGTCCCAGATGCACCGTGCTTGGGAGACAGCCTGGGAGCAGGAGGAGGCCAGCTCATC
TTGAAGGCCCACCCTGCATCTCAGGGAGGACTGAGCCTGGGCACCCTTCCCCACCAGGCAGAGAGGAAGC
ACAGCAAGGCAGGGGCCAGGCGGCATGTGTGTCTCTAGGAGCTCCTCCCCACCGTTAACAAGGCTGCATC
AACACCTCTGTCTTGGAGTTTCCTTCCGGGCGCATCCCAGTGCCAACCAGACTGCTGAGCCAGCCCTTCT
TCCATCCTGTCCTGCTTCTGGCCTGTCCCCCTCCTTGGTCCCAGCCACAAGGACCATTTCTAAGTGCCCC
GCAGAGCAGAGACACAGGGTCAGCCCTGCCAGCCAACCCCCTTGCCTAGCGCTGTCCTGCAAATACAGCC
CAACTGATTTCTCAACATCGGCGAGGGAGCAGAGGAAACTGGTGGGGAGGGTATCATTGCAGTTGGAGGG
ATCAGTAATCCTGGGGGATTATTCGCAGACACTAGCCTGGGACCAAGGATCCCCCTGGCTCTTCTAAAAT
GCCAGGACAGTCCTGGCAGTCAGCCGGGCCCCACCTGAAGCTCTGCTTTCAAAAGGTCGAGAAGAAGAGG
AAGGGGCCTTCCCTCTCCCAGGCCCTCTGCTTCTGCCTGCTTCCGTGGGGCCCAGGGCCTCTGTCCCCAG
GGACAAGGGAGCCCTGGCTGAAGCTCTGGGCCCCTTTCACGTCGAGGCCGGGGACTGCTAATAACCCACA
AATGACTCACAAATAACAGGAAAGCTATTGCAAATCTTCACATGTAAGCACTCAGCAACCACCCCCACCC
GCGGCTCAGAAACAGCCGAGCCAGGCCTGGGGTTCCGGAGGGGCAGGGGCCCCGAGGGCTGGTGTCCCGG
GGTCTCTGGGCGAGAGCAGAGCTTGAAGAGGAGGTCTCAGCACGAGCCCAGAGGAGCCAGAGCTGGCCTG
CTACTCACACAGCGCCGCAGCCGCAGCCGGAGGGTCTTCAGCTTCTCCCCCAGTGAGTTCACGTGTTCCT
TGATGTCAGGCCCGTGGTTCTCAGCCTGTGGCATCACCTCTTCCAGGTAAAACTGGATCATTTCCGACAA
GGCTTGGCAACCCAGGTAACCCTGAGGGCGGAAACCAAGGCGGGTGGTGACCCGGGAGGAAGGGCTACAC
TGCCTGAGAGGACGGCTCTGTTCCCCAAGGACCTTGTTCAGTGGCCACCTCCCCCTGGAACGGAGCCCTT
GGCAACACCCAACACCCTGCCTCCCTCTGGCTATGTGCTGAGTTAAGATCTTCCCACTTCTCCTTTTTTT
GAAGTGAAGGAAGCAGACCCAGCTCCCTGCAGGCGAAGAAGCAGAGTCTCCCTTGGGCACACCGCAAGCT
CCTTGCCCCCGCCAAACGCACTCACCCCAGCCCTCACCTTAAAGTCATCCAGCAGAGACTGGGTCAACAG
TAAGCTGTGCAGTTGGTCCTTCATTTGCTGCAAGAAGAACAGAAGGAGAATGAACCCAAGGTTTGGAGCA
ATACTGAGAAGGACTGTCTTTCTGATATCCTTTTATTGAGAGACTTTTTGATTTTTAGTCAACACAGCCC
TGTCTCCAAAAGGGAAAGGAGAGGTTTTGAAACAGGACATTCAGCAGCGCTGAAGCCCTTAGTTAAACCA
GGTCCTTCCTCCGGGGATCAAGTTCTTTTAAAAACCTGGCTGATTTTGAAGGCAAGGCAGAAGCCTGCCT
GGGTCCCAGTCTTCTTTCTGTAGAGCTGCGTCACGTGTGCAGGGACCCCCATTCCCAACCCCTCAGCACC
CTCTGCTTTGCTGTCTCCAGCTGCAGCACTGACCGTTCTCTGGGAGTGGCAAGCATCTTCTCCTGCAGGT
CTCCCCCTGTATGCGCTACCTCCAACCCATTTGTCATTCAGGTTCTGGAAGCCCTCCAAGCTGAGGCAAC
TTTTGTATCCCTGCCACGGGGTTTTGGGAACATCTTCACCTCCAATCAGATCTCTCCCAGCCAATGAGGT
ATTGAGCTCCAGAGGAATCCTTTACAGATTTTCTAGCATAGGCTAGATGTGCCTTTACATTTTTAAAGAC
AACTTTTCTTGCACAATCTGCTACATCACCAGAGCTCAGATTAACTCACTGAACCCACAGTTTGACCAGG
GACTCTTAAGAATTTCAGCTTCGAGGGGAATGGGTGCTGAGGGTGGAGGTGAGTGAAAAGGAGGCTCTTG
TGAGTGCCTGCAGAATGGCTCTTCCTGCGGTCCTAAGGGAGAAATGAAGGACAGGAGGGCTTTATACTCA
CAAAGAAAGTCTTCACCTTGCCGAAGGCAGCTCGGAGCTCCCGCAGCATGTGGGGCAGGCTGGTTGGCAA
GTGGATACAGCTGCTGTCAGACAGGGTGCTCGCATCTCGGCTGGCTGCCACCCCAGCCAGGAAGACCAGG
CAACAGAGCAGGGCTGAGC
Protein Sequence
>gi|41386772|ref|NP_776513.1| interleukin-10 precursor [Bos taurus]
MHSSALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELRAAFGEAKTFFQMKDQLHSLLLTQSL
LDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVE
KVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK
Molecule Role Vaximmutor
Related Vaccines(s) Bacille Calmette-Guérin (BCG) , Mycobacterium avium relA mutant vaccine
References