VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PCDHB1

Gene Name PCDHB1
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 29930
NCBI Protein GI 14195607
Genbank Accession AC010223
Protein Accession NP_037472
Taxonomy ID 9606
Chromosome No 5
Gene Starting Position 19530
Gene Ending Position 22063
Gene Strand (Orientation) +
Protein Name protocadherin beta 1
Protein pI 5.03
Protein Weight 82950.69
Protein Length 818
Protein Note Also known as PCDH-BETA1; MGC138301; MGC138303
DNA Sequence
>gi|28558729:19530-22063 Homo sapiens protocadherin beta cluster (PCDHB@) on chromosome 5
CAGTAACCTGTTGCAGAAAAGTGAAAGTATATCCGCAACAGTTGGCTCTGATTGCAGAGAGCGCGCTTGT
GAGAACTGATGGCGGGTACGCGCAGAAAATCTTTGCAAAACAGGCAAGTGGGATCTCTTCTCATTTTTCT
GTGCATATCTGTGGGGGATGCGACAACTATCCGCTATTCAGTGGCAGAGGAAATGGAGAGCGGCTCGTTT
GTGGCCAACGTAGCTAAGGACCTAGGACTGGAGGTAGGGAAGCTGGCTGCGCGCGGGGCGCGGCTGGTTT
CCGAGGGCAACAAAATGCATTTCCGGCTCCACCGCAAGACGGGAGATTTGTTTGTGAAGGAGAAACTGGA
TCGGGAGTCACTTTGTGGCAAAGCCGACCCTTGTGTTCTGCACTTTGAAGTAGTCCTGGTGGAGCCGCTG
CAGTCCTTCCGGGCCGAGGTCAGGGTATTTGATATCAATGACAATGCCCCAGTTTTCCTAAACAAGGAGC
CGCTTTTAAAGATTCCGGAGAGCACCCCTTTGGGTTCACGTTTTCCTCTGCAGAGCGCCCAGGATCTGGA
CGTGGGCCTTAACGGTCTCCAGAACTACACCCTGAGTGCCAATGGGTATTTCCACCTGCACACCCGCTTC
TGCAGCCACGGGCCTAAATATGCTGAGCTGGTGCTGAACAAACCCCTGGACCGAGAGGAGCAGCCTGAAG
TCAACTTGACAATTACGGCGGTGGACGGCGGGTCCCCGCCTAAGTCTGGCACAGCTCACATCCACGTGGT
GGTTCTGGATGTCAACGACCACGTGCCCCAGTTCTCGCGACTGGTGTACAGAGCCCAGGTATCAGAGAAC
AGCCCCAATGGCTCTTTGGTGGCCACGGTGACTGCCGTGGACCTAGACGAGGGCACCAACAAAGCGATAA
CTTACTCTTTAGCTCAAAACCCAGAAGCAATTCTCAAGACGTTTCAGATTGACCCTCAAAATGGAGAAGT
TCGACTAAGAGGACCCCTCGATTTTGAAGCCATTGAAACATACGACATTGACATTCAAGCTACAGATGGT
GGAGGCCTCTCTGCCCACAGCAAAGTCCTGGTAGAAGTGGTGGATGTGAATGACAATCCTCCCGAAGTGA
TGGTCTCCTCTGTGTCCAGCCCACTCCCTGAAGACTCACCACCACAGACAGTAGTAGCCCTTTTCACTAT
CAGAGACCGGGACATTCGAGTGGGAGGAAAAGTCACCTGCTTCCTCAGAGAAGACCTTCCCTTTGTAATC
AAACCTACATTTGGGAATTCTTACTCACTGGTCACTGACAGAAGCTTGGATCGGGAGGAGGTCTCAGGCT
ATAATATCACCATTGTTGCCATGGATACTGGACCACCTAGCTTGTCTGCCGAGACTATGATAGAGGTGCT
AATATCCGACGTTAATGACAATCCTCCAATATTTCGGGAAGATTCCTATATCTTGACTGTTCGAGAAAAC
AACAGTCCTGCGGTTTTTATTGGCAAAGTCCATGCTGAGGATCTTGATTTGGGTGAGAATGCCCAAATAA
CATATTCTCTGTTGCCTCCAAAAAACGGAGATCTTTCAGTCTTTGCTTACATATCCATAAATTCAGGCAA
TGGGAAGCTCTACGCGCTGAGAACCATGGATTATGAGGCCATTCAAGATTTTCAATTTGTGGTAAAGGCA
ACTGATGGGGGCTTCCTGTCACTGAGTAGCCAAGTTACTGTCAGAGTGGTTGTCCTAGATGACAATGACA
ATCGTCCAATGATCTTATACCCACTGCAGAACGGCACCTTGCCCTGCAATGACCTGGTGCCCAGGTCTGC
AGAGGCAGGCTACCTAGTGACCAAAGTGGTGGCTGTGGATGGTGACTCAGGTCAGAATTCTTGGCTTTCA
TATCATCTACTTAAGGCCACTGACCTTGGGTTATTTTCTGTTCAAAGACAAAATGGAGAAATCCATACAT
TAAGGCAGATATCTGAGAGAGACCCCATGATGCAGAAATTGATCATTCTTGTTCAGGATCACGGCCAACC
AGCTCTTTCCACTACTGTCTCACTCAACATCCTGCTGGTAGATGGCTTTTCAGAGCCCTACCTGCAGTTC
CAGGATCCAACCAAGCATTCTAGAAAGGTAAATCCATCCACTAAATATTTGGTCATTTCTCTGGTCATCC
TTTCCTTTCTCTTTCTCCTCTCTGTCATAGTGATCTTCATTATACATGTCTACCAAAAGATTAAATATAG
AGAAAAGTTCACAATTCAAGAGCATTTCTATGATGACTGTAATTTCTCTAACAACCTGGTACAAGGACAA
GGCAATGGATCCTTATCTCGGCCTTGTCCATATGAAATGTGTTCAGCCACTGGCACTGGTAATAGTGAGT
TTCGCTTTCTTAAGCGTTTTATGCCCAACTTCCCTTTCCCTCATGCCACTGGGGAGATAAAAATGGAGGC
TGGCTCCAGTTTGCCCCCAAATTCTGATAGGAATAAGTCTCAGAGATTAGAGGGCCATGACCAGGTATCT
GATGACTATATGTA
Protein Sequence
>gi|14195607|ref|NP_037472.2| protocadherin beta-1 precursor [Homo sapiens]
MAGTRRKSLQNRQVGSLLIFLCISVGDATTIRYSVAEEMESGSFVANVAKDLGLEVGKLAARGARLVSEG
NKMHFRLHRKTGDLFVKEKLDRESLCGKADPCVLHFEVVLVEPLQSFRAEVRVFDINDNAPVFLNKEPLL
KIPESTPLGSRFPLQSAQDLDVGLNGLQNYTLSANGYFHLHTRFCSHGPKYAELVLNKPLDREEQPEVNL
TITAVDGGSPPKSGTAHIHVVVLDVNDHVPQFSRLVYRAQVSENSPNGSLVATVTAVDLDEGTNKAITYS
LAQNPEAILKTFQIDPQNGEVRLRGPLDFEAIETYDIDIQATDGGGLSAHSKVLVEVVDVNDNPPEVMVS
SVSSPLPEDSPPQTVVALFTIRDRDIRVGGKVTCFLREDLPFVIKPTFGNSYSLVTDRSLDREEVSGYNI
TIVAMDTGPPSLSAETMIEVLISDVNDNPPIFREDSYILTVRENNSPAVFIGKVHAEDLDLGENAQITYS
LLPPKNGDLSVFAYISINSGNGKLYALRTMDYEAIQDFQFVVKATDGGFLSLSSQVTVRVVVLDDNDNRP
MILYPLQNGTLPCNDLVPRSAEAGYLVTKVVAVDGDSGQNSWLSYHLLKATDLGLFSVQRQNGEIHTLRQ
ISERDPMMQKLIILVQDHGQPALSTTVSLNILLVDGFSEPYLQFQDPTKHSRKVNPSTKYLVISLVILSF
LFLLSVIVIFIIHVYQKIKYREKFTIQEHFYDDCNFSNNLVQGQGNGSLSRPCPYEMCSATGTGNSEFRF
LKRFMPNFPFPHATGEIKMEAGSSLPPNSDRNKSQRLEGHDQVSDDYM
Molecule Role Vaximmutor
Related Vaccines(s) Mycobacterium tuberculosis sigE mutant vaccine
References