VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

HIST1H2BE

Gene Name HIST1H2BE
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 8344
NCBI Protein GI 21396484
Genbank Accession AF531288
Protein Accession NP_003514
Taxonomy ID 9606
Chromosome No 6
Gene Starting Position 26184023
Gene Ending Position 26184457
Gene Strand (Orientation) +
Protein Name histone cluster 1, H2be
Protein pI 11
Protein Weight 13013.18
Protein Length 126
Protein Note Also known as H2B.h; H2B/a; H2B/g; H2B/h; H2B/k; H2B/l; H2BFH; H2BFN; dJ221C16.8
DNA Sequence
>gi|224589818:26184023-26184457 Homo sapiens chromosome 6, GRCh37.p5 Primary Assembly
CATGCCTGAGCCAGCGAAATCCGCTCCCGCCCCGAAGAAGGGCTCCAAGAAGGCCGTGACCAAGGCGCAG
AAGAAGGACGGCAAGAAGCGCAAGCGCAGCCGCAAGGAGAGCTACTCCGTATACGTGTACAAGGTGCTGA
AACAGGTCCACCCCGACACCGGCATCTCCTCTAAAGCCATGGGGATCATGAATTCCTTTGTCAACGACAT
CTTCGAGCGCATCGCCGGCGAGGCTTCCCGCCTGGCGCATTACAACAAGCGCTCGACCATCACCTCCAGG
GAGATCCAGACGGCCGTGCGCCTGCTGCTTCCCGGGGAGCTGGCCAAGCACGCTGTGTCAGAGGGCACCA
AGGCCGTTACCAAGTACACCAGCTCCAAGTAAACTTGTCCCTGCAACTGCCTTAGTAAACCCAAAGGCTC
TTTTCAGAGCCACTC
Protein Sequence
>gi|21396484|ref|NP_003514.2| histone H2B type 1-C/E/F/G/I [Homo sapiens]
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Molecule Role Vaximmutor
Related Vaccines(s) Mycobacterium tuberculosis sigE mutant vaccine
References