VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

HIST2H4A

Gene Name HIST2H4A
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 8370
NCBI Protein GI 4504323
Genbank Accession AF525682
Protein Accession NP_003539
Taxonomy ID 9606
Chromosome No 1
Gene Starting Position 121215050
Gene Ending Position 121215445
Gene Strand (Orientation) -
Protein Name histone cluster 2, H4a
Protein pI 11.91
Protein Weight 10474.58
Protein Length 103
Protein Note Also known as H4; H4/n; H4F2; H4FN; FO108; HIST2H4; HIST4H4; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4B
DNA Sequence
>gi|157704448:121215050-121215445 Homo sapiens chromosome 1, alternate assembly HuRef, whole genome shotgun sequence
GTGGTCGGCCCTAAAAAGGGCCTTTGGGATCGAAACGTGCAAAGCTGGAGCGGCGGCCTAGCCTCCGAAG
CCGTACAGGGTGCGCCCCTGGCGCTTGAGCGCGTACACCACATCCATGGCTGTGACGGTCTTGCGCTTGG
CGTGCTCGGTGTAGGTGACTGCGTCCCGAATCACATTCTCCAGGAACACCTTCAGCACACCGCGGGTCTC
CTCGTAAATGAGGCCAGAGATCCGCTTAACGCCGCCACGCCGAGCTAGACGCCGAATGGCAGGCTTGGTG
ATGCCCTGAATGTTGTCTCTCAAGACCTTGCGGTGGCGCTTAGCGCCCCCTTTGCCTAAGCCTTTTCCGC
CCTTTCCTCTGCCGGACATGACCGCTGGAGCCCGATAGACAGCTTC
Protein Sequence
>gi|4504323|ref|NP_003539.1| histone H4 [Homo sapiens]
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Molecule Role Vaximmutor
Related Vaccines(s) Mycobacterium tuberculosis sigE mutant vaccine
References