VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Cxcl1

Gene Name Cxcl1
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 14825
NCBI Protein GI 6680109
Genbank Accession AC157938
Protein Accession NP_032202
Taxonomy ID 10090
Chromosome No 5
Gene Starting Position 90891244
Gene Ending Position 90893120
Gene Strand (Orientation) +
Protein Name chemokine (C-X-C motif) ligand 1
Protein pI 9.62
Protein Weight 9757.89
Protein Length 96
Protein Note Also known as KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1
DNA Sequence
>gi|372099105:90891244-90893120 Mus musculus strain C57BL/6J chromosome 5, GRCm38 C57BL/6J
CAACAGGACTCAGAGCCTCTAACCAGTTCCAGCACTCCAGACTCCAGCCACACTCCAACACAGCACCATG
ATCCCAGCCACCCGCTCGCTTCTCTGTGCAGCGCTGCTGCTGCTGGCCACCAGCCGCCTGGCCACAGGTA
GGTCTCGCCACTGCCACTGGGGGAGGAGGGACCTCTGGTGAGCGCAGCCTCCCACAGTCCCGCTGACCAA
GAGTCTTCTCCCATAGGGGCGCCTATCGCCAATGAGCTGCGCTGTCAGTGCCTGCAGACCATGGCTGGGA
TTCACCTCAAGAACATCCAGAGCTTGAAGGTGTTGCCCTCAGGGCCCCACTGCACCCAAACCGAAGTCAT
GTGAGTATCTTCCCGGTTAGCTTCTGCCACTTCCAGACTCGCCCAAACCCTCCCGCGCCCCCACACTTCT
CCTAGTGGGAATGCCTAACATGTGGGTCTATCCTTCTCTCTGCAGAGCCACACTCAAGAATGGTCGCGAG
GCTTGCCTTGACCCTGAAGCTCCCTTGGTTCAGAAAATTGTCCAAAAGATGCTAAAGTGAGTTGTGACTT
GTGTTTGTACCCGAGACTAGAGTCAAGGGTGGGAGTACTGGCATATGACCCCTGAACGTTAATTCTATCA
AGGAAAGTCTGTGTTTATCAGGAGGTCGGAAAGTTGTGGTTATTATTTTGGTAATTGACCTTAATTTGAG
ATCATTAATTGGTTCTGATGCTAGAGAATTGTGTCCTCTTGGACACAATTACTATTGTATATTACACAAT
TACTATTGTGTATAATTATTACCACACTCAAAACCCCTATGCAAATGGTCAGTGGCAACAGTTCCTAAAA
GATGGAGAAGTCGCCAATAGCCTTTAAAAGTCTCCTTAGGGGCTGGCAAAGCATGCCCGAGCCTTCTTTT
GCCAGTGAGATTTCCCTGAGTTCAAGGCTAAGGTCTCTGTGAATGTTACATAATTTATTGAATTTAAGCC
AAGTAGGGGAGATAATAGCAGCTATATCACAGAGTTGTGAGTGAGAGAGGATTAAAGTCACACTTGTAAA
TTAACCCATGCTGAAGTAGGTTTTTGTTTGTTTGTTTTTGTTTTTGTTTGTTTTTGTTTTCCAAGTCAAG
TGATTGACTCCACAGGAACCGACAGTACAGAACTCTGGGTGCAAGTGTAGACATGTAGAAAGCCCATCTG
GAGCCTCAGGGGCTGGAATAAAAGAAGAAAGGCTTTGATGACTATTTGTAACAATGACTCTTTTCTGATT
GCAGAGGTGTCCCCAAGTAACGGAGAAAGAAGACAGACTGCTCTGATGGCACCTGTCTGGTGAACGCTGG
CTTCTGACAACACTATACAATTTCTTTTGAGGGTCCTATTTATTTATGTATTTATTTATTCCACAAAGTG
TGTGGTTTTTATTTTACATTAATATTTAACAGTGTGGATACATTTCATCGATGGTAGTTCAGTTCTGCTT
GTTCAGTTTAAAGATGGGTAGGCTTAAAATATTTCATTAAACTAATATTTATTGGGAGACCACTAAGTGT
CAACCACTGTGCTAGTAGAAGGGTGTTGTGCGAAAAGAAGTGCAGAGAGATAGAGTTTAGTATTATGTTT
TGTATGTATTAGGGTGAGGACATGTGTGGGAGGCTGTGTTTGTATGTCTTGAAAAGAATGTCAGTTATTT
ATTGAAAGTCGTCTTTCATATTGTATGGTCAACACGCACGTGTTGACGCTTCCCTTGGACATTTTGTGTC
TAGTTGGTAGGGCATAATGCCCTTTTACATTCTTTAACCCTGTTTCTCCTGGTCTCGTCTCGCTCGGGAC
AGAGACGTTCAAAGGACTGTTACAAATGAAGTAAAAATAAAAGTTTTATTAAAAAAA
Protein Sequence
>gi|6680109|ref|NP_032202.1| growth-regulated alpha protein precursor [Mus musculus]
MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKN
GREACLDPEAPLVQKIVQKMLKGVPK
Molecule Role Vaximmutor
Related Vaccines(s) Francisella tularensis guaB mutant vaccine
References