VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Il12a

Gene Name Il12a
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 16159
NCBI Protein GI 226874945
Genbank Accession AC121306
Protein Accession NP_001152896
Taxonomy ID 10090
Chromosome No 3
Gene Starting Position 68690643
Gene Ending Position 68698546
Gene Strand (Orientation) +
Protein Name transcript variant 1
Protein pI 8.33
Protein Weight 25111.9
Protein Length 236
Protein Note Also known as p35; Ll12a; Il-12a; IL-12p35; MGC151228; MGC151232
DNA Sequence
>gi|372099107:68690643-68698546 Mus musculus strain C57BL/6J chromosome 3, GRCm38 C57BL/6J
CTGCCACCTACTCCCTTGGATCTGAGCTGGACCCTTGCATCTGGCGTCTACACTGCTGCTGAAATCTTCT
CACCGTGCACATCCAAGGATATCTCTATGGTAAAAGTCCAGAAAGGCTAAAGATGTTGTCCACAATCTCT
CGGCAATGACCAGATATATCCCCACCAGTATCACAACTTGCAACGCGCTCCGTTCCCATCTGCCCTCTGC
CTCCCTACTGTGTTGATTCCCATTTCCAAAACTAGCTCAGAATGCATCCCACTGGCAGCCAGGCAATGCC
TTCTTGCAGATCTGGAGGCTTCAGGAGCCTTTGCTGCCTCTTAGGCTCCTGCAGAGAGATGGCCTTGCTC
TCTCTGGGCCCTTTTCCCCCAAGATGCTGTGCAGTCGTCTCACTAAATCAAAACTGCCAGAACTGAGTTT
TAAGCGATATATAGCCACCACATCTATTTTGTTCCTTTATACTTTCAAAGTAGGACAGATTCGCAAAATA
CATTGAGTCAGACTCAGTGTCCACGATGGAGAGACGAGTGGGTAGCTTGTGCTTCTTTAGAAGGGGCACT
GGGCAGCGTGTTAGGGCTAGGGGGTAGTGGGGCAGGACAGACCTGTCCCGGGACAAGAGTGGCTACTCGC
AGGCCGGTTTTGCTTTCGCTCTGAGTGTGGTGGGCGGTGGGACGGTCCCGAATCTCCTCAAACGGGCACT
CCGAGAGTTAATTCGAAAGCGCCACCAGCCTTGGGGGCGATCGACGCACTTGTCCTTGAGATGTAGAGAC
AGAGAGAGAAAGCAAGAGACACAGTCCTGGGAAAGTCCTGCCGGCTATCCAGACAATTATAAAAATGTGT
CTCCCAAGGTCAGCGTTCCAACAGCCTCACCCTCGGCATCCAGCAGCTCCTCTCAGTGCCGGTCCAGCAT
GTGTCAATCACGCTGTAAGTACCTGAGGGCCGGGACCAGGGTGACTTGATGAGAGGAGAAGGCTTGAGAA
AGAACAGACAGAAGCCCTGGACCCATTAAGGGAGACTAAAGGGCTGCCAGCAACTGCAGGCCAAGGGAAG
GAAGAGGGGAAAGATGGTCGTGCTAGATTGCGCTGCACCGAGCATGGTCTCATTATAGAACAACCCTGGG
GGCTACGGCTATGCCCGTTTCACAGAAGAGAACTAAAGCCCAGCCTTGAAACCAATGTAAGGAAAATGCA
GGTCTCAGGCAGTCCCCAAACAAGATCTGGGAGGTCTTGCTTCATCTGTCAGCCCCGGGGAAGGGCTTAA
ATTATGTGTGGAGGGAGGTCAGTACCCAGAATGGATGGAAAAAATTGCCAGAATGGCTGAAGAAAGAGGC
AGGTCAAAACCAAGTTGACAAGCTCCACCTGCCCTTTGTTTCCCTTCCAGACCTCCTCTTTTTGGCCACC
CTTGCCCTCCTAAACCACCTCAGTTTGGCCAGGGTCATTCCAGTCTCTGGACCTGCCAGGTGTCTTAGCC
AGTCCCGAAACCTGCTGAAGACCACAGATGACATGGTGAAGACGGTGAGTTTCTCCTGTCCTTCTGGCTT
CAAAGTTCCGCTGTTGACATGACTTCTAACCTATCTGGTATCTGCTGGGAAGTTTATGGTATCTGGCAGG
AACCGTAGAGGGTTTCAAGACTTCTAAATATAATCTAAAGGAAACTGTGTCTCTAGAGAAAGGAAGAATG
GTAATAAATTGTAACGGCATCGGTTTAGGCTGTGTCTACACAGAGGAAAGTGGGGACTTGCAATGTCCCT
CCCAGCCTGCCTGCCTGTGTGACACAGTGTCAGGTGCTCCCTGCTTCTGCTTCAGGGCAGGTGGAACAGG
GAGACAGTCTCTAGGTACACTCTCTGTGCTTCACAAGCCATAGAGATGAATTAGATTGTCTCTCCCCCTG
CTCACCAGTGTCCAGCACTGTGATGCAGTCCCTTGTCGGATGGACACATGTCAGGGAGGACTCAGACATC
AGATAGCAAGCAGGTCCAGCCTCCAGTTTTCTGGGGCAAGTGTGATCCAGTTTTAGTCACGGCTCCACTC
ATTTTTCTCAGGTTTCATGTTTGAATGCAAAATAGCCTTTTCCGTTGTAAAATTGCCACGGTTTCCTCTC
GCTTTGGGGACAAAGCTACAGCAAAATGCTAATGTGTTTGAGATATCCTGCAGCTGCTAGGGCTGGAGAT
CCAGTAGAATTCTGGCTTAATTATGAATGGGTCTCCCGGGTTCTATCCCCCAACAGAGCGTGCGTTCATA
AGCACCTGGGAACAGAGGAGGGAAGGAGGGAAACTCTGTCTTCCTGTTTTGTTTTTAAATCTTTCTTGAG
GATCTTCTAGCTTGTTGTCTTATGGCTATCCCAACATAAGCTCCGCTCCACAAGCCCTTCTTGGTGAATT
TTCTTTCTTTCCTTCCCGTCTTGCATAACGTGCTGCTGGCTGTTCCTCCAAGCTCAGTCTTAATTGAGTG
GGGTTCCCAGGAGGGAGAGATGGCTCTGTGGTTAAGAGAGCTGGCTGCTCTTCCAGAGGTCCAGAGTTTC
CACACCCTCATGGTGGCTCACAATCATGGTAACTCTGATCATAGGGAACCTGTCGTTTTCTCTGTGCCTC
TGTGGGCACTGAGCACATGCCACACAGACATCCATGCAGGCAGAACACTCTTGGCCATGAAACCTTAAAA
TGAAGGAGAAACCTTACGAGAGGTTCCCTAAGGAATCCCTGCAGAAGGGAGAGATTGTTTTCCTAAGATG
AGGTTTGGTGTGGAGGGGATGAGGTATTCAAAGTTAACTAGCCGCTCCTCACTCCTCTGCTGCCAAATAC
CAGCACTGGGCTTCGAGACACAATAGAATTCGACCTTGTTTTCGTTTGGGTCACTATTGCTCTCTAGTTG
AACACGGAATCCACGGGGGCACATTGCTGTCTGTCCTTTGTCACACCCCAGGACCACAGCTGCATGGAAA
AGTCATCGCAGGCTTCAGTCAGAGAGCTGTTGACTTCCTAATATGTTGTGTAATTCTGTTCAGTGGTGCT
TTCCAGCACACCAGGGAATAAGAGACAGTCCCCGCGTATGTAAATTAAAGCTCAACTAGTATTTAGGGCT
TGCAAGTTTGTTACAGCCATCAAGCTGTGACTTTAACAGTTTCCTCTTTAGAAGTTAAACTTGAAAAAAA
ATAGAGGGAGAGAGAGATTCACAGGGCACAGCTGCTTGGAAAAAGGAAAAGCCACAGGACTCACCAGAAG
CAAGCAGCACAGTGTGGCACTGATGCTGATGAGTACAGCCTGCTGCACCCCAGTGTTCACATGGTGAAAA
AAATACCCTGCTGGCGGACAGCCTAGGCAAAGGGGGAGGAGAGTAGGGAGAGCGTGCGGGAGGTTGGGTT
TCTTAGCTTATGAAGAGCCTGAGTTTCCTACAGGCCAAAGAGATGACGGTTCAGAGTGGCCAGCCTAGGC
TCTGCTGATCCACTGCGATGCAGGTCTCAGAGGGAACCAGCTGTCTTGCTGAGAGATTCACCTCAGCTTC
TCCTTATGTTTTTCCCAGGCCAGAGAAAAACTGAAACATTATTCCTGCACTGCTGAAGACATCGATCATG
AAGACATCACACGGGACCAAACCAGCACATTGAAGACCTGTTTACCACTGGAACTACACAAGGTATGGAG
GACCCCCACCCAAAAAACAACAACAACAACAACAAAAAACACAATTAAGAGCCGTGCAGCCAACCTCAGC
TGTCTCCAGATACTTACTTGTAGCTATCAAACGTGAGAGTTTTGAAGAAAAAAAAAAAAGTCAACAACCA
TACAAATACTTCTACAAGCTGAAGGATATACTCGGTAACTAGGAGGTGGCTATGGTGGTATAGACCTTTA
ATTCCAGCACTTGATGGATAGAGGAAGGCCGGCTCCTGTTAAGTTAGAGGCCAGTCAGGGATACACAGCA
AGATTTCATCTTTAAAAAGAAAGGGGGTGGTGTGGCGGGTGAAGCTTACTTATTGAAGTGCTCATGTCAC
AAGCCTGGGGACCTAAGTTCCCATCCCCAGCACCCATGTAGGAGCTGGGTGTGATGGTTTCACATGCAGA
GACAGGAGGATACCTGGGCCAGCTAGTCTAGCCGAATCCATGAGCTGCAGGCCCAGTGAGAGAACCTGTA
TCAGAAAACAAGAAAGTCAGGAGAGCGGCTGAGAAAGACCCCAAAGATCATCCTCCGATTTCCACGAGTA
CATGCACCTGCACACACGTGCACACAGGAATCCTATACATAGCCACCCAAAAGCAGTTATGATGGTGAAG
TTTCTTTTACTGGAATGAAAAGTTAGTTTGAGAAAAAAATATCAGAGAGATTTATATTAAGAGTGAATGG
GTGGGGGGTATGCATGCCTTTAATCTCAGCACTTGATAGGCAGAGGCAGATGGATCTCTGTGAGTTCAAG
GCCGGCCTGGTCTACAGAGTAAGTTCCAGGACAGCCAGTGCTACAATAGAAACAGGTGATGGTGATGATG
GTGATGATGGCGGTGATGATGATGATGATGACGAAGACAAACTCCTCGGTTTATGATTTTCTTCTAGAAC
GAGAGTTGCCTGGCTACTAGAGAGACTTCTTCCACAACAGTAAGTAAGCACTCTAAGGGTTCCTTCCCCA
TGACGGATTCATAACACTGATGCCTGGTCATTCTTTCTCTAGAGAGGGAGCTGCCTGCCCCCACAGAAGA
CGTCTTTGATGATGGTAAGCCACATCACTTTTCTGAAATGCAGCAGGGTCCTGTAGTTCCAGCCCATCTC
AATGATTCCTTGCCCATTGTGTCCTGCGCTCTAGACCCTGTGCCTTGGTAGCATCTATGAGGACTTGAAG
ATGTACCAGACAGAGTTCCAGGCCATCAACGCAGCACTTCAGAATCACAACCATCAGCAGATCATTCTAG
ACAAGGGCATGCTGGTGGCCATCGATGAGCTGATGCAGGTAAGCCTTCCTCCTATCAGCCAGCGCTCCTT
TTCCATGGTGAAGAGAGGTCCTTTATTAGATATGATAAAATCAGCACAGCTTGGGTTGGGAGAGACCTGA
ACACCCCCACCCCACCCCACACCCTCATCCCCCAACCATGAAAGGCCTTGCAAGGTTACATTTGCTTAGA
GAGCCTTGAGGGGGCCTCTACAATAAGGGCAAATGCAAGCAGCCTTCTACTTGTTGACTCATGATACAAA
TCAGGCACTTTTCAAATGCTTCTTCTCATACCATCCCCACAACAAGCAAATAAGGTCTCTACAGAGGAGG
AAACTGAAGCTTAAGAGGATGAACGAGGGTTCCCTACAAAAGGGTTTTTTGTTGTTTGGTTTGGTTTGGT
TTGGTTTGGTTTGGTTTGGTTTTTCCGAGACAGGGTTTCTCTGTATAGCCCTGGCTGTCCTGGAACTCAC
TTTGTAGATCAGGCTGGCCTCGAACTCAGAACTCCACCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGG
TGTGCGCCACCATTGCCCAGCTTATTGTTGTTTTAAATACATTCTTTTCTTAAAGGTTCAAGATTAGGAC
TGGAGAGACAGTCCGATGATTAAGAGGACTTGAGTTTGGCCTGGGGCTCCTATGTAACAAACAGGGTGTG
GTCCTGAACTGCTCTCTAACTCCAGAGAGTGGAGACAGGAGGCCTATGGAGGCTTTCTTGCTGCAAGTTT
AGCCATGAAATCTCCAGGTTCAGGGAGAAAGCATGCCTCAAAGAAATAAGATGGAGAGTCACGTGATCTC
TTCTCTGGCTTCTGCATGGTGTAGGCACAGATATGCACATGTTTGAGTGCATACAATACAGGCAAACATA
CACGTGTCCTTTTTAAAATGTATAGGATGGACATTCTAGGGGCTGCACACATATTCAAATATTACTAGGG
GAAGCACTTGGGGCTGGTGTCCAAGTATAATCTATTTTGAACCAAAATGTGACCAAAATGAAAAGTGGTC
TTACATCTAGGTAATTACAGTGTTAGGTATCCGTGGGAACTTTGCTGTACCACCAGTAACACAAAGCACA
GGAGTGTGCACACCAGAGACAAGCACCTTGGCAACCAAGGCGTGGGATGAACATATGTTCAGAAGTCACT
GCCTGGAAAGCAATTGTTTTTCATTTCATACATACTGTCTTGCACAGGGTTTCTATGTCTTAGATAAAAT
ATCATGACGGAAAGCAAGTTGGGGAGGAAAGGGTTTATTTCATCTTGTAGAGTGTAGTGAGTCTATTACC
CAGGGAAGTGGAGGCAGAAGCTGATGCTGGAGAGGACTCCTGGTGACTGGAGTGCTCCACATGACTTGCT
CAGTGTGCTTTGTATAGCACCCAGGACCACCAGGCTAGGGTGAGCTGGTGCCTCCCACATCAACTGTCAA
TCAAGAAAATCACCAGAGGCTTGCCCACTGGCCAATCTGGCTGGAGGTGTTTTTCTCAATGACCACAGGC
TTGTGTAGAGTTAACATAAAAGCACCCAGGACATTACATATTGCCAGATGACTCCTTTGAAAGACAGTGA
AGTTTATGCAGGTCAAACAACCTATCATGTAGAGATTTGTAATGGATATTGCATGAACAAGGCCAGAAGT
CAGGTGATTTGGATAGTAGGAAGAGGTCTACCAGGGACCAGCCAACTATGCTGACAGGGTTAACTCTTGT
CAGCCTGTTTGTAAAATAAGATGACTTTAAATAGCCTATGTCTCTCTTGAGATTTTTGTGAGGAGCAAGC
AAAAATCTTAAACATCACAGAAACCTAAGTTCTTATTCTATGTTATGAAATCAAAGGATCGAGTGGGGAA
ACACGGTACTGGCTTGTTTATCTACCACAAATAGCGTTTCTATCAGAGATAGGTCTGTTGTTGATAATAA
GCTCTAATCCATAGATCCTACTTACCCTCCAACTCCCTCCTCTAAAAGAACAGGACTTCTTAACATAATT
TATAAAAATTAATTAGCTATTGCTGCAGGTGCTACCTCATAGACTCACACCTTCTGAGAGATCAGCTCTA
ATGACAATTTCTTTCTGGAAAATTTAGGGGTCTTGTCAGAGATCATTAAAAACATAGGTATATGCTCACA
AAAGAGTATTTCTTCCCTCTTTTCCTGCAGGAACACAGCAGGAGTAGATGTGAAATGGGTCTAGGAGTGT
GATGAGGGGCTAGGTTGCAGGCCCTGGACTTTGCATTGACTGTCTCCCATTTTGCAGACAAACATTCTAA
TTTTTAAATTGTGCATATGCTATGCTTGGTGTTTCTTTCTAGTCTCTGAATCATAATGGCGAGACTCTGC
GCCAGAAACCTCCTGTGGGAGAAGCAGACCCTTACAGAGTGAAAATGAAGCTCTGCATCCTGCTTCACGC
CTTCAGCACCCGCGTCGTGACCATCAACAGGGTGATGGGCTATCTGAGCTCCGCCTGAAAGGCTCAAGGC
CCTCTGCCACAGCGCCCTCCTCACACAGATAGGAAACAAAGAAAGATTCATAAGAGTCAGGTGGTCTTGG
CCTGGTGGGCCTTAAGCTCCTTCAGGAATCTGTTCTCCCATCACATCTCATCTCCCCAAAGGTGGCACAG
CTACCTCAGCATGGTCCCCTCCATCGCTTCTCTCATATTCACTATACAAGTTGTTTGTAAGTTTTCATCA
AAATATTGTTAAGGGGCGAAGACGTCCTCCCCTCAATGTGTTAGCAGAAGAGCAAGAACTGATAAGCTAT
TGTTTTTGTGCCAAAGTGTTTATGAAAACACTCAGTCACCCCTTATTTAAAAATATTTATTGCTATATTT
TATACTCATGAAAGTACATGAGCCTATTTATATTTATTTATTTTCTATTTATTATAATATTTCTTATCAG
ATGAATTTGAAACATTTTGAAACATACCTTATTTTGTGGTTCTAATAAAGTAATGTTATCACTT
Protein Sequence
>gi|226874945|ref|NP_001152896.1| interleukin-12 subunit alpha isoform 1 [Mus musculus]
MVSVPTASPSASSSSSQCRSSMCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTDDMVK
TAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLC
LGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKM
KLCILLHAFSTRVVTINRVMGYLSSA
Molecule Role Vaximmutor
Related Vaccines(s) Dengue DNA Vaccine encoding NS1 Protein , Francisella tularensis guaB mutant vaccine , KKF24
References