VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Ccl5

Gene Name Ccl5
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 20304
NCBI Protein GI 164698428
Locus Tag RP23-320E6.2
Genbank Accession AB051897
Protein Accession NP_038681
Taxonomy ID 10090
Chromosome No 11
Gene Starting Position 83525777
Gene Ending Position 83530517
Gene Strand (Orientation) -
Protein Name chemokine (C-C motif) ligand 5
Protein pI 8.73
Protein Weight 9475.12
Protein Length 91
Protein Note Also known as SISd; Scya5; RANTES; TCP228; MuRantes
DNA Sequence
>gi|372099099:83525777-83530517 Mus musculus strain C57BL/6J chromosome 11, GRCm38 C57BL/6J
CTTTGTCCTTGCATCTGAAATTTTAATGAAATGCTGATTTCTTGGGTTTGCTGTGCAGAGCCTCGGAGCA
GCTGAGATGCCCATTTTCCCAGGACCGAGTGGGAGTAGGGGATTACTGAGTGGCATCCCCAAGCTGGCTA
GGACTAGAGCAAGCAATGACAGGGAAGCTATACAGGGTCAGAATCAAGAAACCCTCTATCCTAGCTCATC
TCCAAATAGTTGATGTATTCTTGAACCCACTTCTTCTCTGGGTTGGCACACACTTGGCGGTTCCTTCGAG
TGACAAACCTGCAGGAGAGAGGAAGGTCAACACTGGGGCAGCGTTTGGTGTACGGGCACGGAAAAGCATA
AAGGTGACAAGAGCCGGGGAGTGCGTTTTTGTAGCTCCATACTGTTTTCTGCCTTTTAGAGGGTAAGTCT
TCTCCTTTGGAACCAGAGGCACTGAGCTACAGGCAGAGTTCCATTTGGGTTAATTCCCTACAAACACACA
GATTTGGAACCCAGCATTGAGCAGGCCAAGCTCTGGCCTTTTCTTGGCCCCTTTCCTTGCTCCAGGCCTT
ATGCTGAGTGACGAATTTAGAGACGTTGCGTTTGATTCACTTAAATCAGTTGAGTTGAGGAAATTAAGAG
GGAACTCTAAGACTGCCTAGTTGTTGCTCTTGGCATTCTAAGCCTGTAGCCAGGGAGTCAAAAGGCTAGG
ATACCAACTCCAGCTATCAAGATTGCTCAGGCCCCCATTTCCCCGTCCTTTATACAGTATGTGATACCAA
AGAACAAATCTCCTTTGCTAAGTCTTTCCTTCTTTCCTCCACTTTTGGAGCCTCTGTTCATCTGACTTCC
CCTTCCACCTGTCTCTTAAGAGCAGGTGTCCTCAAAGAAATTGTCCCCCTTACCTTCTCCCTTTTCCAAT
CTCTGGCCCCAGGCCTGCATATAGTTGATGCTTGGTGAATATTGGATGAATGACTGGATGAAAGAATCAC
ATTCATTCATTCTTACCACATGTATGCATTCATGTGCGCACGCACACACACACACACACACCTGTGCACA
CATGTGTGCGCACACACACAGACACACAAATAATATCAATAGTAAGTTGATACTTCTTTATACCCATTAT
GTGCCAGGGAATGGTCTAAGTGATTTTTTTTTTCTGTGTCCTAGTGAAAGAAATGCCTTAATTATCCTCT
TTTGGAACTACCTCAGAGAGGTTGAGGGGCCCCAGTTTATCAAACAACATAACTAGGATTCTAGCATGCA
GACCAGCTGGGTGGCCAAGGATGACTAAGACAATGTTGCCCAGCCTCTTTTATTGGCAGTTCCTGGACTC
TGTCTTCAGCCCTTGGGTTGCACTCCATCTGGCATCTCCATGGATTATCTTGCTGGAACTTTGCTTGGTT
CCTTCCTCTTTACACAGTTGGCCCTCTAGACCTGCACACCTGCACACCTCTCCGTCTCTGACTGGGAACC
TCAGCATCTGCATCTCTTCTGTCCTTGCTCCTGACCACAAGTCCCTCACTCTGGCTGACTCATCCTCCCA
CACTCCTGACTCTTGTTTCTTCTGGCCTCCAGGTACCACCACTCTGCTGACAATAGTACACGTGTGGGTG
ACTTCAACCGCCTCTTCTCCAGACCCCCTCCTAGGCTTTGTCTGGACCTGGTCATTTTACTCTTGCCAGC
TCTAGGTTTTGCTTCAGTTTCCTGACACTTGAGGTGCCCTCTGCTTTCCTACATATGTCCCTACAAACCA
ACGTAGGTGTCCATGTGTTCTCAGATACACCCGTGTCACACACATCAGATACACCCATGTCACACACACT
TCTCTACTCCTAATCTTGACACAAATAGCATCTTTTTACAGTAATCACCTGCCTCACCCTTGAAGCTAGA
CACACCCCCTCCTCTCCTCTAGTATGGTTTTATAGGGTGCCGTAGATCATTCTGTGTCCAACTTATCAGT
CTTACTAGATGAAATTTCCATAGCCAAGGATGACAATTTTATTCATCTCTGCCGGCTCATAATAGGTTCT
CAAGGAAGGATTTTCTTTAAAAAGTTTTATTTTAGAGCTAAATTTGGTAATATTAAATAGTAATATTACA
CTGAAGTTCATCTTTGCCAGGGTTAAAAAAAGTCATTGGATTAAAACTCTTCAACCTTTTATTGGAAACT
TTATGATTTCTTCTTTTTCTTTTTTACATTTATGTAGATGAGTATTCATCTGCATGTATTTGTGCACCAC
ATGTGTGCCTGAGGAGGTCAGAAGAGGGTATTGGATCCCCTGGAACTGGAGTTACAGAGTGAGCCATTAT
GTAACGAGTGAGCCATCATGTAACCAGTGAGTCACCATGTAACGAGTGAGCCGCCATGTAACGAGTGAGC
CACCATGTAACCAGTGAGCCACCATGTAACGAGTGAGCCACCATGTAACGAGTGAGTCACCATGTAACGA
ATGAGCCACCTTGTAACGAATGAGCCAACGTGTGGATGTTGGGATGGAGGTTGATCCTCTGCAAGAGCAA
GCAGTGCTCTTAACCATGGAGCCATCTCTCCAGCTCTCCGTTTTCACTCTGTAAATCGTTATCATCTTAA
GCTTCTTAAGCTATCCTGTCACTAATGACTTTATTTTAATACAGGAAGTAGGTCCAGAGACAGACTGCAT
CCCTCACTTACTGTGCAGCTTTGAGTAGGCCTGCAAATGCCTCTGAATCTGTTTCATTACGTGGAGAAAT
TTGTGCATACCCGCCAGGGCTATGCACAATTTAGAGACAGTACACATAGACACAACATGCCAGCAAGCAC
CCTATTATATTCCCCAAATCTATCAATATGCATATTTAAAGCTGAGTCTCATTATAACTTCTTAAATGGA
TAGGGTTTTAGATTTTATTTACTTGATTGAAATTAGGGAACTGACCTTGATCCATCCTCCCTAGTTCCTC
AGAGGATTAGGCAAAGGTTGGTGTCCTAGGAACTGTGTCTATCTCTATAGGCAGGAGCCTCTAAGGCTAC
GGTTCTCAACCTTCCTAATGCTGCGGCCCTTCTCATGTTGTGGTGACCCCCAACCATAAAACTATTTTTG
TTACTGTTTCATAATTGTAATGTTGTTACTGTTATGAATTGTAATGTCAATATTTTTGGAGATAGAGATT
TGCCAAAGGGGACCCGACCCACAGATTGAGAACTGCTGCTCTAGGGCTCCCTGTGTCTAGTCCTTTAATG
TTACAGTTGGAGACTCTGAGCTGGAGACGAGGAGCCATAGCTATTAGAGGAGCCCAGAGAGTGAGTGGGA
GTGAGAGGGGGCACCCCTGAGAAGGATCACGGCGGGGTTGTGGGATGGCTTCTATACCCCACAGAGGAAC
CCATGGGGCTGAGACTCACACGACTGCAAGATTGGAGCACTTGCTGCTGGTGTAGAAATACTCCTTGACG
TGGGCACGAGGCAGCGCGAGGGAGAGGTAGGCAAAGCAGCAGGGAGTGGTGTCCGAGCCATCTGGGAGAA
GGAAGAAAGGAAACCCTTTTATTCATTGCCAGCTATGCTGGGCTCTTTACACGATTTATCTTAAAAGCAG
TGACTGTCGTTGTCGACCTTGGCAGAAATGGCTCAGAGGACACATTTGCCATGGTGGAGAGTTCAACAGA
AGCCTGTTTTGTCTGGTCCGTGAGCCAAGCCTGTGCCTTGTGCTCTGTACCGTAAGCCCCTGCTGGGATC
CCTCTCCTCGCTCTGTGCCTTCTGCCCTTAGCAGGGCTTTCAGAGCTCCCCTGGTGGATTCAAAGCTTGG
TGTCTTCGAGGTGTAGCATGAGTTCTGGGGGAGTGCCCAAGCCGAAGCTCCATAACTTAGTGACGATCCT
AAGAGGGGCCTGAAAGTGCACATAGCATCCTGGGACCTGGCTGGCCTGTAGCGAGGGGCTCTGACCAGAG
AAGCTCTTGGTGGTCACTTAATTCATCCCACAGCAGAGCTGTGGTGCTTAGCTTCCCAGTCAGATAGGGC
TTTTGGAATACCAGTTTCCACAATTGTAGCAGTGTGCACCCTTAGACAAGAATCTCAGTGTTCTTAGGCC
TCTGTTTCCCACTGCAACACAAGAGCAACTACTGAAAGACTATTTGTATTAAACAGGATGGCACATTAAA
CTCATTTGCACAGTGCCTGACCCACGGTAGGTACTTAGTTCACTATCTATCTATCTATCTATCTATCTAT
CTATCTATCTATCTATCTATCTACCTATTTATTTTGCAAGCCCCATTTCTTTTCTCACTATGAAATGAAA
GACCATCCTACCTAAAACAGTATCACACATTTCTTAGAAACCACACTGGTGACAGATATGAGCAAGTCAT
TTTTCAAAGGTCAGCCCGGCACCAGTTCACAATAAGGAGTGCCTGCAGAATTCATAATATCATCTTTGAA
GACACAGAAAAGTTCCTCAGAGGATCCTGCCATTAGTATACAAGACATCTAACAGTGATGACAGGGTAGC
CGTGTCAAGGATGCGTAAGAATGTACAGCAGCATACACAGTAGGATTGGAAAGAAGGGGAGGTCTGGGTA
TCAAGATGGGTTGGCATCGAGGCAGAGTGGGGCTGTGATGGTCAGAACCCTCGACTTACATGGTGAGGCA
GGTGCGGGGGTGCAGAGGGCGGCTGCAGTGAGGATGATGGTGAGGGCAGCTGCAGAGATCTTCATGGTAC
CCGCGGCAGAGGCTGTGGGAGATGCATGTGCTGTCTCAGAGTCCTCTGCAA
Protein Sequence
>gi|164698428|ref|NP_038681.2| C-C motif chemokine 5 precursor [Mus musculus]
MKISAAALTIILTAAALCTPAPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNR
QVCANPEKKWVQEYINYLEMS
Molecule Role Vaximmutor
Related Vaccines(s) Francisella tularensis guaB mutant vaccine
References