VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IgA

Gene Name IgA
Sequence Strain (Species/Organism) Homo sapiens
NCBI Protein GI 2632187
Other Database IDs CDD:209398
CDD:197704
Taxonomy ID 9606
Gene Strand (Orientation) ?
Protein Name IgA
Protein Length 131
Protein Note Immunoglobulin domain; cl11960
Protein Sequence
>gi|2632187|emb|CAA10818.1| IgA [Homo sapiens]
LQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISVDT
SKNQFSLKLSSVTAADTAVYYCASRVGYCSSTSCYTFDYWGQGTLVTVSSASPTSPKVFPL
Molecule Role Vaximmutor
Additional Molecule Role Vaximmutor
Related Vaccines(s) Aro-deleted S. Typhi , CVD 908-htrA , S. sonnei strain WRSS1 , SC602
References